CAZyme Information: AO090005001553-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090005001553-T-p1
• CAZy Family: GH105
• CAZyme Description: Ortholog(s) have cellulase activity and role in xyloglucan catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36958.20	4.1785

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr1_A_oryzae_RIB40:2279578-2280943(-)

Full Sequence      

MKFRNLFFAAVAGSAVAAPLAKEQKKRDSVFQWIGANESGAEFGENNLPGVWGTDYIFPD
VSAITTLIDKGMNIFRIQFKMERLVPDSMTGAYDEAYLQNLTTVVNAVTDAGVHAILDPH
NYGRFNGEIMSTPSDFQTFWKNLAGQFQSNSLVIFDTNNEYHDMDQELVLNLNQAAIDGI
REAGATEQYIFVEGNSYTGAWTWTDVNDNMKNLEDPQDKIVYQMHQYLDSDGSGTSETCV
SGTIGQERVTSATQWLKDNKKVGIIGEFAGGNNDQCKTAVKGMLDYLAENTDVWKGALWW
AAGPWWGDYMYSLEPPNGVAFTGMLDVLQAYLG

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	33	310	8.7e-112	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.30e-74	37	303	2	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	2.29e-21	29	315	43	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88581.1|GH5_5	9.38e-255	1	333	1	333
BAE56461.1|GH5_5	9.38e-255	1	333	1	333
QMW25446.1|GH5_5	9.38e-255	1	333	1	333
QMW37515.1|GH5_5	9.38e-255	1	333	1	333
UCK57867.1|GH5_5	9.38e-255	1	333	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	1.10e-194	30	332	1	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	9.69e-194	30	332	3	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	1.00e-193	30	332	4	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	8.60e-174	30	332	2	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	4.90e-171	30	332	3	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MW97|EGLB_ASPFN	1.67e-255	1	333	1	333	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
sp|Q2UPQ4|EGLB_ASPOR	1.67e-255	1	333	1	333	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	7.12e-202	1	332	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	4.41e-198	1	332	1	331	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1
sp|A2QPC3|EGLB_ASPNC	4.41e-198	1	332	1	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.045396	0.954575	CS pos: 17-18. Pr: 0.9031

TMHMM  Annotations     

There is no transmembrane helices in AO090005001553-T-p1.