CAZyme Information: AO090005001526-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090005001526-T-p1
• CAZy Family: GH10
• CAZyme Description: Ortholog(s) have glucan endo-1,3-alpha-glucosidase activity and role in fungal-type cell wall (1->3)-alpha-glucan metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		54412.39	4.6737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr1_A_oryzae_RIB40:2362221-2364076(-)

Full Sequence      

MSKETIHISEAMLLGILTLVLAGFLALAAATPVAQHMTDNLATDKLVFCHFMIGITSNRQ
SAADYDDDMKRAKALGIDAFALNIGVDPYTDAQLNLAYESAAKNDMKVFLSFDFNWYNTG
QASAVGAKIKQYASLPAQLMVDNKVFASSFAGDGLDIPAMQSAAGTDVFFAPNFHPGVGD
FNAIQGALNWMAWDNNGENKAPSPGHNVTVADGDKSYVDALKGKPYIAPASGWFFTHFGG
EVSYSKNWVFPSDLLWYDRWQQILSLEPRFVEIVTWNDYGESHYIGPLASPHTDDGASKW
VMDMPHTGWLEMSKPFIAAYKAGDKSVDKYITDEKLIYWYRPTPRDVNCDSTDTTMEGNP
NNSSGNFFRGKPNGWETMQDAVFVVALLKSPAIVAISSGENSKTFEAQTGASAFTVPMGV
GQQKFAITRDGKNIMEDTSLKDIVDTCICGIYNFNPYVGTVPAESTIDKLEQAGLAMLSQ
GLKVPCPTNTLGASGPRVTP

Enzyme Prediction     

EC	3.2.1.59:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	47	436	1.8e-146	0.992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	0.0	47	436	1	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	1.74e-108	42	323	2	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	5.14e-23	47	310	1	276	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56438.1|GH71	0.0	1	500	1	500
QMW37554.1|GH71	0.0	12	500	1	489
UCK57893.1|GH71	0.0	12	500	1	489
QMW25469.1|GH71	0.0	12	500	1	489
QRD88556.1|GH71	0.0	12	500	1	489

PDB Hits     

AO090005001526-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GX22|MU71A_PENRW	5.43e-102	28	460	19	429	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O13716|AGN1_SCHPO	1.45e-70	44	461	21	422	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|O94510|AGN2_SCHPO	1.77e-32	44	455	10	425	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.323138	0.676829	CS pos: 30-31. Pr: 0.6149

TMHMM  Annotations     

Start	End
13	35