CAZyme Information: AO090005001017-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090005001017-T-p1
• CAZy Family: CE2
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN8986, Aspergillus versicolor : Aspve1_0047420, Aspergillus clavatus NRRL 1 : ACLA_018770 and Aspergillus sydowii : Aspsy1_0051004

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		47555.29	9.2104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr1_A_oryzae_RIB40:3713547-3714840(+)

Full Sequence      

MAMHPQRQRKLSIGGRKLLLLLLAALIYLVLYHLPPPPKTKNNTSSNRKAPKYDVDTTPR
FLHLSSFREDPDSEYEKRVSDALLEIERNALRASNWDTSAEDRIWQVALGKYIERESDSL
EFERENSGWKYSLVDDKKASKFITEIFSSVPDLKKMYDSYPYHVIRSDLIRYLILWYYGG
FYADMDVYPARAIKECPALEPLWEDGSKSPNVSLVVGIEIDEPHASPRLMREWRWIRRYQ
LIQYTLYAPRRFSPILREVIVRVMAHTRRQINQSNFLRGPRYKENTILEVTGPGVFTDAV
LDVLSRTLPPTHSLVESSVNADADIGDLVSPSTGVTQRRVTWAPFNRIREPVCVDASEAM
DGKPMGGVCVLPVNVWGNGQRHSGAEGFSSKHACINHRFGRTWRKGWLEYFFG

Enzyme Prediction     

No EC number prediction in AO090005001017-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	125	196	2.8e-19	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	4.44e-14	114	203	2	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	1.60e-08	101	203	83	184	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW25899.1|GT32	4.96e-286	1	413	1	413
QRD88070.1|GT32	4.96e-286	1	413	1	413
QMW37982.1|GT32	4.07e-285	1	413	1	413
UCK58385.1|GT32	4.07e-285	1	413	1	413
BAE56002.1|GT32	1.71e-193	156	413	1	258

PDB Hits     

AO090005001017-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.68e-21	122	404	127	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	8.31e-19	96	405	104	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.62e-16	104	404	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.74e-15	122	351	154	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	8.19e-07	96	187	65	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000003

TMHMM  Annotations     

Start	End
13	35