CAZyme Information: AO090003001503-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090003001503-T-p1
• CAZy Family: AA7
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu6g14040/och2, A. niger CBS 513.88 : An05g01750, Neosartorya fischeri NRRL 181 : NFIA_059930 and Aspergillus niger ATCC 1015 : 189528-mRNA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		46258.95	4.7554

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:6117568-6118782(+)

Full Sequence      

MTSSMSGVCLPRQIRRIIPGCLAAILFVSYLSMTDTFSELSDGLSYRSCETHRFFPKKIW
QSWKVAPFEFEERDLTVARSWTSKNPGYRYEVLTDQNDLYYVETHFGPDGFNRPDIVDTY
RTLTAQIIKADLLRYLIMYVDGGVWADIDVEALRPIDRFIPERYDEHDIDMVIGVEIDEP
DFNDHPILGQKSQSFCQWTFMAKPRQPVMMRLVNHILEWLNELSVKQGKPIGELELEFDD
IISGTGPSAFTAAVLAEMSINAGHEVTWKTFHDIPESKLVGGFLVLTVEAFAAGQGHSDS
GNHNSRNALIKHHYHASGWPSKHPRHNHPVYGEVEQCNWNKECVAQWDANTAAFAALSPE
EQEHQIALKRALDAEANPVQDQTAWINPDPDPEWREPEWQPEWQ

Enzyme Prediction     

No EC number prediction in AO090003001503-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	162	6.4e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.34e-24	33	283	59	312	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.24e-13	72	162	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83354.1|GT32	8.21e-310	1	404	1	404
QMW40889.1|GT32	3.35e-308	5	404	1	400
BAE58544.1|GT32	3.35e-308	5	404	1	400
UDD56882.1|GT32	3.35e-308	5	404	1	400
QMW28814.1|GT32	3.91e-307	5	404	1	400

PDB Hits     

AO090003001503-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.11e-33	52	319	139	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.52e-30	50	291	125	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	3.85e-29	38	312	81	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.07e-21	39	234	79	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.87e-07	56	160	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999759	0.000259

TMHMM  Annotations     

There is no transmembrane helices in AO090003001503-T-p1.