CAZyme Information: AO090003001409-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090003001409-T-p1
• CAZy Family: AA7
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		67106.97	5.4404

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:5889715-5891607(-)

Full Sequence      

MAITEQPYDYIIVGAGVGGLVLASRLSEDANTTVLLVEAGPNHMGDPRVETPGLLGAMME
NPDFDWDYLTEPQVYANNRQLGQPRGRMVGGSSALNFSLVMYPSRANFEAWESLGNDGWG
PDAMAPYLRKFHTYTPPSETTSALLSVDKYMNAENQGDQGPLPISHLDIYTPWNRAWDDT
FARLGWNNHADPIAGRKVGSFTPPLSVDGKTGQRGYAGAYYTQDVAERKNLHLLTETMVE
RVILKKADSRVTATGIQIRTKNGQQLEVSATREVIVSAGSLNSPQLLELSGIGAADLLQK
HNIPVVLDLPAVGENLQDHCMSTVNFEVADPQTSADIARDPKVVQSLVELYEKTRTGPMT
GIPVSVAYLPLVDHNGQVQREQIDDLLAQYLDSPQVKQISLGRQQQYKILRQMLRDDQTG
SADYMFLVAQFNAKEGVNTMSYALSKDLPENYINILVLHNHPFSRGSIHIQSANAGDKPI
YDPKYLSHPLDLEILARHTQFLDKIASTEPFSSLLKPGARVPKAAVDLADLDTAKEVVKD
RLFHCCHPVGTCAMMPAELGGVVDTQLKVHGTHNLRVVDASIFPLELSGTIQATTYAVAE
RAADIIRATAHC

Enzyme Prediction     

No EC number prediction in AO090003001409-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	608	1.4e-181	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.45e-96	1	612	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.95e-92	3	607	1	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.75e-36	462	602	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.99e-32	8	594	56	564	Protein HOTHEAD
366272	GMC_oxred_N	3.13e-27	76	319	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW28733.1|AA3_2	0.0	1	612	1	612
QRD83267.1|AA3_2	0.0	1	612	1	612
UDD56791.1|AA3_2	0.0	1	612	1	612
QMW40805.1|AA3_2	0.0	1	612	1	581
BCR96633.1|AA3_2	3.70e-309	6	607	5	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.54e-75	5	607	3	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.73e-75	8	607	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6O9N_A	8.89e-61	5	606	33	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	3.62e-59	8	608	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.02e-58	8	608	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	2.06e-103	5	607	11	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.06e-103	5	607	11	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.55e-100	3	608	9	618	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.22e-86	4	607	36	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.80e-75	6	606	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993029	0.006989

TMHMM  Annotations     

There is no transmembrane helices in AO090003001409-T-p1.