CAZyme Information: AO090003001375-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090003001375-T-p1
• CAZy Family: PL1
• CAZyme Description: Ortholog of A. nidulans FGSC A4 : AN11144, AN8627, AN11697, A. fumigatus Af293 : Afu6g00520, Afu8g07260, A. niger CBS 513.88 : An09g01560, An12g10160 and A. oryzae RIB40 : AO090701000504, AO090102000039

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	Chr2_A_oryzae_RIB40|CGC10	50194.30	7.2976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:5806831-5808150(-)

Full Sequence      

MTAFRPARHPPRGRITWISPILGLLVILFIYMNHQNASAPIAFPQRQQNANTDCPDLPGL
EDIFVVLKTGVTEARDKVPIHLQTTLRCIPNYIIFSDYAEKIHNVQLHDVLENVAEDIKQ
SNPDFSIYNRVRAAGRTALTSADLNPDTNSAFGKPNNPGWKLDKWKFLPMIEETLKARAD
AKWYVFMEADTYFFWPNLLSWLAQLEHQQPYYLGNQMQIADVVFAHGGSGFVLSNPAMRA
AVTLRRENVDMWDRVTNDHWAGDCVLGKLMADAGVGMLWAWPVLISGQPSELDFFSEGYR
KKPWCYAPVAYHHLGPDQIRELWEFERKWYRDGNRKHVLYRDVFRHIVRPKLGGTVAGWD
NRIEETPGKSSLSLVECRVLCYRDDKCVQYTYTDGKCWTSHVPVRGAQKDGVASGWITER
VDALVDDMGSCPHAKWILS

Enzyme Prediction     

No EC number prediction in AO090003001375-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238531	PAN_AP_plant	0.002	370	410	30	72	Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions. S-receptor protein kinases and S-locus glycoproteins are involved in sporophytic self-incompatibility response in Brassica, one of probably many molecular mechanisms, by which hermaphrodite flowering plants avoid self-fertilization.
367085	Fringe	0.005	180	240	84	158	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58433.1|GT31	0.0	1	439	1	439
QMW28702.1|GT31	0.0	1	439	1	439
QRD83231.1|GT31	0.0	1	439	1	439
UDD56757.1|GT31	0.0	1	439	1	439
QMW40773.1|GT31	0.0	1	439	1	439

PDB Hits     

AO090003001375-T-p1 has no PDB hit.

Swiss-Prot Hits     

AO090003001375-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000027

TMHMM  Annotations     

Start	End
13	32