CAZyme Information: AO090003000923-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090003000923-T-p1
• CAZy Family: AA5
• CAZyme Description: Beta-1,3-exoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	Chr2_A_oryzae_RIB40|CGC7	79886.91	6.2004

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:4599521-4601910(-)

Full Sequence      

MATMANGQDVFLPVSTGPIPGTVKSRNDHPVPRASIMNNTDPIETNKFYAGLFLGTQTNT
TFTHPYGIAWAKGNGNAKSYGMAISHIEADKLALGPKNDKIPGSPVQYYVNPIGIQSIIL
SATELGGSTVLMTENPLPFSANAVLQPQSGSSERITFPVVQGMGFVTGIYSNLQPVIQSS
VFFSKVVSAGSPRPGIFKYTVDLADGTNWLLYLTSNDGKDPNLHLESTTNLRGPPGWSGT
VQVAKNPAGTLGEKLFDNSSGVYATQGWVKGAVSGQTGTYSLTWGKEGKDKDGTPLMMYA
LPHHVESFDKTTHDRLTNITMRTTTKGNATAVIGETWSMVEQDLPVGMGFAPWSVSAGSV
DTISPAAQKVIIDVAPTELQQDVGNQSNLNSMYYSGKALSKFATLVYAVDKLGGKPDLAA
PALKDLKTAFARFIDNKQQFPLVYDNVWKGVVSSASYDGGDSGADFGNTYYNDHHFHYGY
FIHAAAIIGSLDPSWIQGNKDWVNMLVRDAGNAATNDPLFPFSRGFDWFHGHSWAKGLFE
SFDGKDEESTSEDAMFAYALKMWGKTIGDASMEARGNLMLGILRRSLHNYFLLEADNKNH
PPVFVPNKVTGILFENKVDHTTYFGANLEYIHGIHMLPLLPVSPYTRSQKFVKEEWDALF
ATNAAAPAEQVQAGWKGVLYANLALIDPVSAWNFFAQPNFDYSVIDGGATRIWYLALAAG
ELTTHSSGFISTTNNI

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	27	716	1.8e-228	0.9919614147909968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	11	720	56	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	362	715	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.04e-158	29	354	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58039.1|GH81	0.0	1	736	1	736
ABX90783.1|GH81	0.0	1	736	1	736
QRD82801.1|GH81	0.0	1	720	187	906
QMW28320.1|GH81	0.0	1	720	187	906
QMW40391.1|GH81	0.0	1	720	187	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.20e-108	5	719	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.78e-108	5	719	28	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.36e-105	5	719	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.25e-28	393	697	340	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.34e-22	393	712	361	675	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	2	725	186	906	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.50e-183	9	720	2	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.70e-167	9	720	401	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.10e-164	29	720	66	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.27e-160	9	722	427	1142	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995835	0.004187

TMHMM  Annotations     

There is no transmembrane helices in AO090003000923-T-p1.