CAZyme Information: AO090003000153-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090003000153-T-p1
• CAZy Family: AA3
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42351.36	5.8936

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:2507402-2508517(+)

Full Sequence      

MASKHPASEIHRVIDLLIDNLINIRDDKGEFLLHLKDGRTIQAKCWNGWEWTHGIGLYGV
WKFYEITGQAKYLKIIEDWFAERFAEGGTTKNINTMSVFLTLAYVYEKTGNLTYLPWLDA
WGEWAMYELPRTKYGGMQHITYVAENDQELWDDTLMMTVMPLAKIGKLLNRPEYIAEAKR
QCLIHVKYLFDTKTGLFFHGWKFENGGHGNGGHNFADARWARGNSWCTIVIPEILELLEL
EPNDAIRTHLCDTLEAQCEALQQSQSVSGAWHTLIDHPDSYLEASATAGFAYGILKAVRR
RYIGSQYRAMGEKAISSVLKDVDEKGELQNTSFGTPMGHDLQVYKDIPLTAMPYGQAMAI
MALGEYLWTYL

Enzyme Prediction     

No EC number prediction in AO090003000153-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	44	366	7.8e-107	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.17e-96	20	371	7	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	8.59e-83	23	367	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57376.1|GH105	7.52e-287	1	371	1	371
UDD55560.1|GH105	4.35e-286	1	371	1	371
QMW39716.1|GH105	6.95e-282	1	367	1	367
QRD82054.1|GH105	6.95e-282	1	367	1	367
QMW27645.1|GH105	6.95e-282	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	9.28e-167	7	366	5	368	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	8.44e-160	9	370	25	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.73e-157	8	370	25	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	1.45e-16	150	344	199	387	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	4.75e-14	49	321	23	301	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.14e-49	39	369	21	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	8.88e-09	166	326	10	177	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	8.88e-09	166	326	10	177	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AO090003000153-T-p1.