CAZyme Information: AO090001000308-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090001000308-T-p1
• CAZy Family: PL27
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity and membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	Chr2_A_oryzae_RIB40|CGC11	50573.11	6.4395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:783730-785160(+)

Full Sequence      

MKIWRQRASRPVRVLLYLLALVLLLWIVLPYDHPIRLSARFNVTAFGTALTSYLGGRWWF
SERSTFPIVLSDDVAVLMKSGFGTKDRIAAWLEAHEHDKFNNLLLVGDFATPSGQLFNYN
GRRLPVSDLVAWMLEKGYLSAELAHPRLMKHSNLSTAISNGDVDIAKELSKSFGWELDAL
KFISGLELCYDQMPDKKWYIMADDDTYLMQPALKLLLEHLDPEVPLYVGNAVGDYKGRFA
HGGSSVILSQATMRLLFSHREVVTSAHLESLEETWGDKLLATTLLKLGIYLDERYAIFFN
GGPPRAIRVTEDRLCAPIISFHSLTPSEMINVGRRFQHTDEVLLWIDLWDIYGAPSLDSP
VLESGRKDWDHVGGLDESTMTVNEVSTSQRCIQICQNYSKSCLAWTWESEKQLCHISNWM
VPGEQAEGKTSGINVPRAKNLVSMCRS

Enzyme Prediction     

No EC number prediction in AO090001000308-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	6.60e-04	166	251	66	154	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
214680	PAN_AP	0.004	375	418	14	57	divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56843.1|GT31	0.0	1	447	1	447
QMW46572.1|GT31	0.0	1	447	1	447
UDD63456.1|GT31	0.0	1	447	1	447
QRD93690.1|GT31	0.0	1	447	1	447
QMW34518.1|GT31	0.0	1	447	1	447

PDB Hits     

AO090001000308-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JJ06|C1GLT_MOUSE	2.26e-06	181	273	146	240	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q9JJ05|C1GLT_RAT	3.01e-06	181	273	146	240	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q5F3G7|C1GLT_CHICK	3.03e-06	181	273	147	241	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
sp|Q9NS00|C1GLT_HUMAN	3.99e-06	193	273	159	240	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q0VC84|C1GLT_BOVIN	9.49e-06	181	273	146	240	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000000

TMHMM  Annotations     

Start	End
12	31