CAZyme Information: AO090001000158-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090001000158-T-p1
• CAZy Family: AA1
• CAZyme Description: Putative pyranose 2-oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	Chr2_A_oryzae_RIB40|CGC4	70210.90	7.4418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:354370-357387(+)

Full Sequence      

MSMTSGRQAFTSECRDSNTTNSFWLANSPTLTLGSTMQVVGSGPIGATYAKILADAGKDV
LMVETGTQESKIAGEHKKNAINYQKDIDAFVHVIKVISSRISTFECISLTFDLLLFQGSL
HYTSVPTNKAAVPTLAPISWKANGQIFNGQNPRQDPNVNLDANGVARNVGGMSTHWTCAT
PRQKEKVERSDIFSGDEWDSLYKEAEKLIGTSKTVLNDSIRQELVMEILNDEYGKRSAEP
LPLAAKRNGNTAYITWSSSSTILDAMNCKKKFTLWPEHHCEKFKVEETDNGPQVTKAIIR
KLATDKLITVKAKVFIACGGPILTPQLLFNSGFVPTKPNRDPRTQIPLEDDEKGIPPPPD
TLEHLKLPALGRYLTEQSMCFCQIVLKKEWIEAVANPKKNPYQSDGVKRKKWEKLKEGWK
ERVQEHMKRFNDPIPFPFDDLDPQVTLPLDYHHPWHTQIHRDAFSYGAAPPAIDKRTIVD
LRFFGTVEPDWKNYVTFETDIRDAYGMPQPTFRYKLNDEDRKRSHQMMKDMEEAAGALGG
YLPGSEPQFLAPGLALHVCGTTRAQKKEKECDPDPKETSCCDENSKIWGIHNLYVGGLNV
IPGANGSNPTLTAMCFAIKSAKSILEGNS

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	626	6.4e-269	0.9872495446265938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	0.0	39	625	5	543	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
398739	GMC_oxred_C	7.39e-15	502	619	12	142	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	3.96e-11	38	626	11	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56707.1|AA3_4	0.0	1	629	1	629
QMW46713.1|AA3_4	0.0	39	629	11	601
QMW34644.1|AA3_4	0.0	39	629	10	600
UDD63603.1|AA3_4	0.0	39	629	11	601
QRD93534.1|AA3_4	0.0	39	629	10	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BG7_A	3.80e-132	39	626	51	611	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
2F5V_A	4.62e-132	39	626	23	583	Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus Peniophora sp. [Peniophora sp. SG]
2F6C_A	4.62e-132	39	626	23	583	Chain A, Pyranose 2-oxidase [Peniophora sp. SG]
3BG6_A	5.36e-132	39	626	51	611	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]
1TT0_A	5.36e-132	39	626	51	611	Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_B Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_C Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_D Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],2IGK_A Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_B Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_C Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_D Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_E Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_F Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_G Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_H Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	2.40e-205	39	624	27	574	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q75ZP8|P2OX_LYOSH	6.31e-141	34	626	35	601	Pyranose 2-oxidase OS=Lyophyllum shimeji OX=47721 GN=p2ox PE=2 SV=1
sp|Q5G234|P2OX_TRAPU	5.46e-134	39	624	51	609	Pyranose 2-oxidase OS=Trametes pubescens OX=154538 GN=p2ox PE=1 SV=1
sp|Q6UG02|P2OX_PHLGI	1.21e-132	37	624	49	607	Pyranose 2-oxidase OS=Phlebiopsis gigantea OX=82310 GN=p2ox PE=1 SV=1
sp|P79076|P2OX_TRAVE	1.95e-131	39	624	51	609	Pyranose 2-oxidase OS=Trametes versicolor OX=5325 GN=P2OX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AO090001000158-T-p1.