CAZyme Information: AO090001000063-T-p1

Basic Information

• Species: Aspergillus oryzae
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus oryzae
• CAZyme ID: AO090001000063-T-p1
• CAZy Family: AA1
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	Chr2_A_oryzae_RIB40|CGC10	40102.59	4.3235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AoryzaeRIB40	12364	510516	274	12090

• Gene Location: location=Chr2_A_oryzae_RIB40:139178-140337(-)

Full Sequence      

MRSSIALLAATAGTTLASSNNYTEWMASSWLSKSVPVSRNYAYGVLYRGIELAHNKTNNA
EYLDFIESQLSGVVSDSGELIDYNLTDKISLDDLRIGTNFLAAWAATGQEKFKLGADTLR
RQIDITPRNEGGGLWHRDPTYPNQMWLDGIYMSTNFYALYTAWFDADNSTAWDDIMLQFD
LIEEHCLREDGLLVHGFDYSKAAVWADPETGAAPLVWNRALGWYFMSLLDILDYFPKSHP
GWETNLSRFQKLAQALKQAQDESGGWYLIMNDQYPSDPRNYIESSGSAMFTYGFLKGIRN
GFLEESEYSQVADKGYKLLVDRFVSKNDNGTLNWEGTVEVGSLSSNGSFEVSPDVY

Enzyme Prediction     

No EC number prediction in AO090001000063-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	348	6.5e-85	0.891566265060241

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	9.93e-58	41	334	36	312	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	5.45e-55	41	333	29	302	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56623.1|GH105	2.76e-270	1	356	1	356
UDD63694.1|GH105	4.79e-265	1	350	1	350
QMW46792.1|GH105	1.95e-264	1	350	1	350
QMW34727.1|GH105	6.52e-263	1	350	1	350
QRD93441.1|GH105	6.52e-263	1	350	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.55e-61	22	343	4	322	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.54e-44	36	330	35	322	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.61e-44	36	330	25	312	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	5.93e-13	217	319	208	307	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	2.86e-12	217	319	225	324	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	7.92e-44	36	330	35	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	7.00e-20	173	356	20	205	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	7.00e-20	173	356	20	205	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002411	0.997571	CS pos: 17-18. Pr: 0.9641

TMHMM  Annotations     

There is no transmembrane helices in AO090001000063-T-p1.