CAZyme Information: AN9329-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN9329-T-p1
• CAZy Family: GT57
• CAZyme Description: protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877		99254.14	6.5113

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVIII_A_nidulans_FGSC_A4:300464-303670(-)

Full Sequence      

MAALPFALSLGSTKTAIIAATVDSGLVQDLEKRGLLNVTDVRGQWETFRTTVVTDYQKGK
DALVIAGSDKRAVVYGIYTLAEQCGQSPYHYWADVPPTWHSTIYALPKTTKQGPPSVKYR
GLFINDEAPALTSWWSKKHSVDHYPLDAEFYRHVFDLILRLKGNFIWPAMWASHHEPMQR
ATNEWNSSETGEWDWTVNKAKVTRFMREGVRRAAKNETYFTLGMRGASDSAISAPDPIAL
LEEVFETQRDMLTEEYGNLSDVKQVWTTYKEVATYYAGGLNPPEDVTLVFTDDNWGNIMR
LPNAEEAARPGGIGLYYHFEYVGRPKSYKWQNTNNLAKVYKELSQALERGADRIWVFNVA
DIKPMELPFAFAMDLVWSSSRFDFSTIPRYLKAFVLRELGCKDNEAEEIASILLQHSELV
GRRKYEGVTSATYSFYNYHEVERVLQEWEDLGDRVTKALAFMFSASQAAFTHLVQYPVQA
GLIYHRIVLGQTINQQFAIQRRTQQIQLQSKSSQRLKQTQISEKSFMPCLAANGMGLWTN
QSWSNGNGRRGCTLLGTLFRTCHLCSRDRTSFITWVTWEYTLRDREVPLCSPPILPTMDP
YGPAFYTVDLFHRGNHRKPISFNLSIPYEWINISLVSGKLSQENPEERLTVSIDWPKVPE
SFNETVLIDIHYDTQPHFENLHIPILNRPALPAGFHGFPATNGYVSIEAAHSQRAISGSD
TVSFKALPHLGTRTKSGAVALRPYEAARVSTSTAQNTRVEYDVFLLGSSKNLTATLFLTQ
NSDTDPSLPMQYSLAIDSSEASFTRLLQEPETPGDLPDIWTDQVEDEVWTVQVQLGPVSA
GKHTLAWRVNSPEVYLEKVVLDTAGAVRKSYLGPPER

Enzyme Prediction     

EC	3.2.1.131:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	11	521	1.5e-180	0.7245337159253945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406396	Glyco_hydro_115	1.27e-175	113	426	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
407695	GH115_C	7.72e-45	697	876	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66396.1|GH115	0.0	89	877	78	866
UQC81939.1|GH115	2.12e-297	16	876	101	1016
BAE63119.1|GH115	2.22e-285	10	877	86	969
QKD58010.1|GH115	8.12e-267	12	854	95	989
CDP27858.1|GH115	3.48e-255	17	876	97	1015

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.31e-131	17	874	69	930	Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	1.37e-104	5	494	84	595	Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.02e-103	17	494	69	580	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.94e-103	17	494	68	579	Chain A, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	1.16e-78	13	720	61	811	Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

AN9329-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AN9329-T-p1.