CAZyme Information: AN9213-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN9213-T-p1
• CAZy Family: GT41
• CAZyme Description: Has domain(s) with predicted hydrolase activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	ChrVI_A_nidulans_FGSC_A4|CGC7	92192.15	5.0970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:85183-87901(-)

Full Sequence      

MHAEAIEMLNSHEAIPVDPSNISAIETHSHQKRIVHALGLLGVQILSRLGAEALQSVIGE
LIEFFTTDDIIWTSRDNCRAYFSTQGGGNEEFRTYAKDHRQATAVDKKNVGWINPESTAP
PVHFFEGDPAIGLYSVQFTATDKVAWSGIPNTEKCKIEGLCNPQYIFYHKGYRIVLNTWE
SQGRVSACQYSKGEDCKGLCASGVKDQFTSGGVKWGGDCAIPCIDDVPEGFKKVQNEEAR
FMVVGDSISHGMEDDWTWRYRLSQWRTRGMDPISISQPRAPLLPDEEPREDYTGKSLGDY
AKGVSQSFRDKGHASFWGRQVAQSKEQFKAWVSEYNPDYLLILLGFNDLGWWVNGPEALV
GDMANLINDARKAKSDIKLLVGNVVDRTFIPGRQDLVDETAQYNKLLKESMKDWYREGSP
ISYVDVNSNYNCRPGGCPDGHDGLHPNALGEYHIAQSFARVLQSDFGYMGIEFRVPETVD
SRPVSTPANVRSNSYPEGLWAVWDRVENARGYEVRWRLKGATSWWSEGAVYPVTNCAWQP
WVINGQTWEFQVRTMGDNTVRSGWSALQSVTANVKTAPGPSNIIVEPRGNDLVVRWDAVT
DYNVDRYGVMLYDRDKEDELMDVKAAKGTSLEITGLNSGHRYGVWVASYVGMVGSLSRNG
IQAGGLPSVAREVIIGRGTPAPPAGLRVENLDATTVRLQWDKVSSATGYSVHVRSIIDNT
AFRVDGTTTQTSYEVAWLFPGNWNFEFCISAYNGNLESAPVSCIIPPVCCGYEKRDLVAT
EYPKAENNSAFSNSISSFGGMSVGSLFTTFQQSIGLALDTASDHSLAIPGEI

Enzyme Prediction     

No EC number prediction in AN9213-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	240	462	4e-43	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	7.86e-48	297	462	6	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.18e-13	297	450	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	7.59e-09	327	461	56	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238020	FN3	1.62e-08	680	764	1	89	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
238872	SGNH_hydrolase_like_2	7.69e-08	307	460	35	190	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ09962.1|CE0	2.17e-116	168	767	437	1051
SCG40251.1|CE0	9.01e-106	240	766	337	864
AVT40037.1|CE0	7.01e-59	242	648	346	755
CAK39824.1|CE0	9.18e-51	240	489	140	394
BAE63679.1|CE0	8.28e-50	240	489	58	317

PDB Hits     

AN9213-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN9213-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AN9213-T-p1.