CAZyme Information: AN9134-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN9134-T-p1
• CAZy Family: GT4
• CAZyme Description: Rhamnogalacturonase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507	ChrVI_A_nidulans_FGSC_A4|CGC13	53449.20	4.4958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVI_A_nidulans_FGSC_A4:340352-342037(-)

Full Sequence      

MYVSRLLLFLAPLLVKGQLSGSVGPLTSVSSKSQTKTCNVLDYGAVADKSTDIGPALSSA
WDECADGGVVYIPPGDYAIETWVKLSGGKACAIQLDGIIYRTGTDGGNMIMIEHTSDFEF
FSSTSKGAFQGYGYEFHAKGSSDGPRILRLYDVSDFSVHDVALVDSPLFHFSMDTCSNGE
VYNMAIRGGNMGGLDGIDVWSTNVWIHDVEVTNKDECVTVKSPSKNILVENIYCNWSGGC
AMGSLGTDTDISDIVYRNVYTWKSNQMYMVKSNGGSGTVSNLVLENFIGHGNAYSLDIDS
AWSSMSTIEGDGVELKNVTIRNWKGTEADGSQRGPIKVKCASGAPCTDVTVEDFAMWTES
GDEQTYVCENAFGDGFCLADGDGTSTFTTTLTASAAPSGYSAPSMDADLETAFGTDSEIP
IPTIPTSFYPGATPYSALAGASVSSSQVPAASSSAEAKFVASPATSSPTATSTAISSVDP
VSAATTTATSHGHGKSHHKHQCRAHRH

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	67	371	3.4e-53	0.9446153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	1.71e-21	39	374	48	392	polygalacturonase
215120	PLN02188	2.72e-21	28	371	27	390	polygalacturonase/glycoside hydrolase family protein
177865	PLN02218	5.84e-20	37	352	67	404	polygalacturonase ADPG
395231	Glyco_hydro_28	7.48e-20	139	371	79	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
165802	PLN02155	9.32e-17	31	373	21	380	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50898.1|GH28|3.2.1.171	0.0	1	507	1	507
EAA61967.1|GH28|3.2.1.171	0.0	1	507	1	517
BCS23384.1|GH28	7.51e-295	1	505	1	520
QMW46234.1|GH28	3.70e-261	7	459	9	460
QMW34178.1|GH28	3.70e-261	7	459	9	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	9.64e-235	18	440	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	3.40e-22	45	374	23	377	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	2.98e-08	195	332	167	310	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	0.0	1	507	1	507	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|B8NK45|RHGA_ASPFN	6.58e-262	7	459	9	460	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1
sp|Q2U293|RHGA_ASPOR	1.88e-261	7	459	9	460	Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgA PE=3 SV=1
sp|A2QYE5|RHGA_ASPNC	1.42e-253	6	441	7	442	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|P87160|RHGA_ASPNG	1.57e-250	6	441	7	442	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000425	0.999540	CS pos: 17-18. Pr: 0.9795

TMHMM  Annotations     

There is no transmembrane helices in AN9134-T-p1.