CAZyme Information: AN8986-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8986-T-p1
• CAZy Family: GT34
• CAZyme Description: Ortholog of A. oryzae RIB40 : AO090005001017, Aspergillus versicolor : Aspve1_0047420, Aspergillus clavatus NRRL 1 : ACLA_018770 and Aspergillus sydowii : Aspsy1_0051004

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	ChrVII_A_nidulans_FGSC_A4|CGC15	47432.12	7.8593

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:215468-216779(+)

Full Sequence      

MRRASRQSFLPLLARRRLSFLLILLFLLFLLHALPPVFSQRRNRRVVGGKWLPDYDVNEL
PRYLHRSPYREKPDIEFEQRVREALKGIEEDALAAAGIGDDRLAEQRIWQIRLGGGNDEH
VEDSLAFTKRNSEWEYTLMTDHQANEFIATVLASIPDLKALYDSYPYHVMRSDLLRYLVL
WYYGGYYADMDVYPAKAIKECPALQPVFGDSGSANISLAVGIEIDEPHASLQLMRDWHWI
RTYGLIQYTFFAPRRFSPLLREVIIRVLSHTRQRNQQSFPFVGPRYDEKAILEVTGPGVF
TDAILDALSDALPTTHPLLAASVRADEGIGDLFSQASGQLSRRVTWAPFHRISEPLCVDA
QEAAVGKSMGGICVLPVNAWGNGQRHSGAGGFSSPLACVNHRFGGSWKKDWWYRHFG

Enzyme Prediction     

No EC number prediction in AN8986-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	128	201	2.5e-19	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.85e-12	105	275	83	250	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.70e-10	129	198	13	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64318.1|GT32	8.31e-312	1	417	1	417
BCS21634.1|GT32	2.63e-220	5	417	6	414
QMW25899.1|GT32	4.02e-167	53	417	51	413
QRD88070.1|GT32	4.02e-167	53	417	51	413
QMW37982.1|GT32	3.27e-166	53	417	51	413

PDB Hits     

AN8986-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.06e-21	106	410	101	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	8.65e-19	54	410	47	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	8.27e-17	108	410	146	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.19e-15	108	355	134	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	1.13e-09	133	192	87	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.349996	0.649988	CS pos: 39-40. Pr: 0.6212

TMHMM  Annotations     

Start	End
20	39