CAZyme Information: AN8964-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8964-T-p1
• CAZy Family: GT34
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	ChrVII_A_nidulans_FGSC_A4|CGC12	49794.60	8.2583

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrVII_A_nidulans_FGSC_A4:277630-279187(-)

Full Sequence      

MGNRPTAKHRRGLQGCQSYSCDARCEVCHPKWRTHAMARRKQYCQWDHHRPGSHEQHDVR
SGNGNCVDTTRRYVGEVLSRTGEAYIIQRLINTEGRMVAGGREGKVGIGGLLTGGGKTFY
TCRNGFACDQVVNYELVLADGSISNANSTTNPDLFRALKGGGNNFGVVTRFDMTTFSAVD
VWDCTITYPKKATLQLSEAIVDLTKNLAAYPDDHILAMWTYLPKTEEHFVMVNMMNLEGV
KEARTLEKFLGIPEQMNRVDTTVSVATKLTSFVVPSGKYDTWYTTTFKADPQIILKSASV
FESLVSALKNQVPYSNFYTQIVLQPLPVSFGAHSTARGGNMMGLDQMKVDCVLLVWAVEV
DTPELNANVAGPTLKSAIEKIETYARSVKGDVGFRYLNYCDKEQDALGSYGEENVRHMKE
VAGKYDPDGVFQKRVPGGFKISRAGGLSAL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	92	433	3.8e-34	0.7838427947598253

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	0.003	123	171	146	199	FAD/FMN-containing dehydrogenase [Energy production and conversion].
395556	Sulfotransfer_1	0.007	213	288	144	215	Sulfotransferase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16207.1|AA7	1.96e-12	58	440	181	556
ADI58761.1|AA7|1.1.3.-	2.84e-12	85	206	112	236
AAS79317.1|AA7|1.1.3.-	4.03e-12	85	206	137	261
QRW22693.1|AA7	8.94e-11	53	217	95	270
EGX49222.1|AA7|CBM1	1.89e-10	90	431	245	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HSU_A	5.97e-14	85	206	118	242	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	1.40e-13	85	206	118	242	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6FYD_A	5.29e-13	93	222	124	252	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	9.36e-13	93	222	124	252	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYG_A	9.36e-13	93	222	124	252	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0U5GQ05|DRTC_ASPCI	4.75e-63	97	443	171	515	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	2.47e-56	97	444	132	479	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|M2T7Z1|TPCD_COCH5	8.07e-45	79	442	150	518	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|D7UQ40|SOL5_ALTSO	6.14e-35	87	441	171	514	Bifunctional solanapyrone synthase OS=Alternaria solani OX=48100 GN=sol5 PE=1 SV=1
sp|G3Y424|YANF_ASPNA	2.94e-28	98	443	242	578	FAD-dependent monooxygenase yanF OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=yanF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AN8964-T-p1.