CAZyme Information: AN8465-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8465-T-p1
• CAZy Family: GT31
• CAZyme Description: Putative alpha-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	ChrV_A_nidulans_FGSC_A4|CGC3	103711.19	6.0078

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:572003-574795(+)

Full Sequence      

MEVTRCGIHGFHETLGIDTDEIRFFWVLEGGCSRSEQTAYRIAVSSEKKGLEEQPDAWDS
GRVESDAQRNIICKPESGFKSTTTYYWQVTVWDQEGKESKSAVNDFYTSYPRSSRLLPPY
SMNQTYMPHTNLIFRTWFENEADRWKAVWIGNGGDKPIYLRKSIQLSSAKRVEKVVIFAS
GLGHFNLFVNGKPASTHVLDPGWTNYHRTVQFVGYNVTPQWSEKENVIGAHVGNGFYAGD
QGDRFFWPMYEDNTYVRYGNELCFFAEIHVHYDDGSHETIISDPSWKVRKSATTLANIYA
SEDHDRRGYPFGWDTPGYDDSTWASAKPLTGPRGKLRYQSQPPVILHNLFTPVKHKQLRP
GVTMFDLGQNSSIMPRVEVSGPAGSEIIIRYSETVDDVGSVFMPDPLFKEFEYGVYSKLI
LSGTGVEIWTPDFSFTSARYIQIEGASLDETDNLPTIHSVSARHISSAARQLGYVKTDRK
DVNDLINACYWTFSSNIFSYHTDCPQIEKFGWLEVTSLLAPATQYVRDMEAVYSKILDDI
IDTQESNGLVPTMAPEIRYMCGPLHDTITWGCAIAFLPELIKRYYGSTEVFGKIYQPCIR
YMEYMKTKERQGGLIEHGLGDWGRDIAFGNHQANIETAVYYRCLRNVALMAKELGQADDE
AKFTAWAERIYAVYNKHLLINDKASRPYAFYTSLDNPGTYDCTMVAQAVALQFGLVPVEH
RAEVIKAFLSACEASGNRIEAGEIGLKYLWNTLAEPDVDRPDIVLAMARQEEHPSYMRFL
RRGETTLLEFWQDACRSKCHDMLGTIYEWFYEAVLGVKPVGDAYKTWTLRPPFVSEFGLV
EGEVDCPYGLIKVRFERGESGKVRLDVRIPTSTNCRLVLPVGARVVAGLPTKVRVSSKSE
IHLPQGEHQLVVSL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	356	879	1e-120	0.996031746031746
CBM67	155	330	3.8e-30	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.04e-125	470	814	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	1.47e-78	170	348	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	8.94e-30	356	466	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	4.92e-23	816	894	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA67087.1|GH78	0.0	1	914	1	914
BCS28263.1|GH78	0.0	1	913	1	912
QMW35313.1|GH78	0.0	1	911	1	914
QMW47375.1|GH78	0.0	1	911	1	914
QRD91716.1|GH78	0.0	1	912	1	915

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.18e-81	15	912	44	907	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	5.64e-65	1	880	4	995	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.02e-49	1	880	2	847	Crystal structure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPL4|PLH28_FORAG	2.42e-72	15	879	44	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
sp|P9WF03|RHA78_ALTSL	1.05e-71	10	892	39	891	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
sp|Q82PP4|RHA78_STRAW	2.64e-64	1	880	4	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
sp|T2KNB2|PLH20_FORAG	6.59e-64	10	880	43	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AN8465-T-p1.