CAZyme Information: AN8453-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8453-T-p1
• CAZy Family: GT31
• CAZyme Description: Protein with pectate lyase activity, involved in degradation of pectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	ChrV_A_nidulans_FGSC_A4|CGC8	27511.17	4.0672

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:536752-537719(+)

Full Sequence      

MFIKNGLLLSLATSVLATHGARSHSQAATSKLSKRFTFPIPNSEGSVTLDEVYEIDGETF
DGGMKTYGRGVSCTGQDEGGDSDAVFIVKNGGTLKNVIIGSDQIEGVHCEGSCTIENVWW
EAVCEDALSLKTGDGPFNVVGGGAQGADDKVIQHNGGGTVSISDFTVYDFGKLYRSCGNC
GDQYERHVVIEGVTAVDGKYLVGINSNYGDTATIDSATCATDVKTICAEYKGTDNNDEEP
EEVSDGPSDYCIYTEPLSEC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	44	232	1.4e-80	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	6.89e-118	37	237	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA67075.1|PL3_2|4.2.2.2	2.96e-194	1	260	1	260
ABF50894.1|PL3_2|4.2.2.2	2.96e-194	1	260	1	260
BCS21544.1|PL3_2	8.47e-164	1	260	1	258
EAA64647.1|PL3_2	1.74e-139	1	260	1	264
BCS21965.1|PL3_2	1.95e-128	1	260	1	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	2.70e-26	57	178	14	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.47e-24	47	179	9	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.51e-24	47	179	10	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	1.36e-23	47	179	18	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	1.36e-23	47	179	18	148	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ATC7|PLYH_EMENI	5.26e-195	1	260	1	260	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|Q5BA88|PLYD_EMENI	3.09e-140	1	260	1	264	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q0CJ49|PLYD_ASPTN	4.95e-125	7	260	6	253	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	5.28e-122	38	260	20	242	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	5.28e-122	38	260	20	242	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003874	0.996103	CS pos: 22-23. Pr: 0.9205

TMHMM  Annotations     

There is no transmembrane helices in AN8453-T-p1.