CAZyme Information: AN8329-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8329-T-p1
• CAZy Family: GT22
• CAZyme Description: Putative glucose oxidase-related protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	ChrV_A_nidulans_FGSC_A4|CGC24	67435.31	5.7509

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:146679-148714(+)

Full Sequence      

MAYPADTSAVDGLESQIFDFVVGGGGTAGLVVANRLFEDSKVRVLVIEAGSNSVRDPRIS
IPGLAASTYFDPDFDWCITSPPQQMLNAILLLLQDGLNGRQIAEPRGRTLGGSSAINLGM
VIYPSKKGVDSWEELGNPGWNWASLSEYLRKSETFTSPSPSIRDELSLGYIDETLQGGNG
PVHISFGDGPYPAFSAAWPKVFENLNHRLTGDPISGVSKGAFCNPATINPKDKSRSHAGV
AYYNKEVAKRPNLRVLADATVARIVLKIEADGSLVATGVQFTPKDGVQRTVAAAVEVVLS
AGAVKAPSCWSYNANVGENLQEHGFVPFSWEIADGRQSGEALRDPAVAQMAMEAWQQHSG
AGPLGLCPLASAYMTLPSLQDGELKALLKQYLDDDQYPRRPGCEAQYHILRQMLEDETEP
SGQYTLAPFQITPEKGPSPKGIFGMSEPECFVSIVSVLNRPFSRGHVHLASSDPYAPPVF
DPKFFSHPLDLEIHARHTQWLETLASTEPMASLIKKHGRRLHSSKRVDDLDTARELTRDR
IVAHYHVTGTTAMAPRESGGVVDERLRVYGTKNLRVVDAGIMPLIPRGNIQAIVFALAEK
AADLIKEDLRDSSFNDVICF

Enzyme Prediction     

No EC number prediction in AN8329-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	18	608	3.6e-142	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.15e-70	18	608	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.03e-59	15	606	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.84e-37	461	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.55e-19	98	323	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	6.84e-10	7	594	45	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17771.1|AA3_2	1.93e-288	6	608	5	611
BCS13057.1|AA3_2	1.10e-279	6	608	5	613
BCS01313.1|AA3_2	1.10e-279	6	608	5	613
CAK40027.1|AA3_2	3.81e-275	6	608	4	612
BCS27275.1|AA3_2	1.74e-202	6	612	5	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	9.61e-63	13	612	1	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.29e-52	18	608	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.67e-51	18	608	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.95e-51	18	610	6	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	5.28e-50	18	611	36	644	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.06e-79	5	608	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.06e-79	5	608	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.51e-78	8	608	4	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	2.41e-62	13	605	42	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.41e-62	13	605	42	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000016

TMHMM  Annotations     

There is no transmembrane helices in AN8329-T-p1.