CAZyme Information: AN8327-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8327-T-p1
• CAZy Family: GT22
• CAZyme Description: Protein with polygalacturonase activity, involved in degradation of pectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		39359.75	3.6868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:142834-144133(+)

Full Sequence      

MFYALGPLALFAFATEVMATPVAYPMTTASPTLAKRDSCTFSGSDGAASASRSQTDCATI
TLSDITVPSGTTLDLSDLEDDTTVIFEGTTSWEYEEWDGPLLQIKGNGITIKGADGAKLN
PDGSRWWDGEGSNGGVTKPKFFYAHDLTDSTIQNLYIENTPVQAVSINGCDGLTITDMTI
DNSAGDDAGGHNTDGFDIGESSNVVITGAKVYNQDDCVAVNSGTSITFSGGTCSGGHGLS
IGSVGGRDDNTVDTVTFKDSTVSNSVNGIRIKAKSGETGEIKGVTYSGISLESISDYGIL
IEQNYDGGDLDGEVTSGIPITDLTIENISGSGAVDSDGYNIVIVCGDDACSNWTWSDVEV
TGGEDYGSCENVPSVASCST

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	54	379	1.9e-73	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	4.33e-125	57	378	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
178580	PLN03003	9.80e-29	108	377	114	380	Probable polygalacturonase At3g15720
227721	Pgu1	6.72e-25	122	346	216	455	Polygalacturonase [Carbohydrate transport and metabolism].
177865	PLN02218	1.60e-22	107	371	156	417	polygalacturonase ADPG
215540	PLN03010	4.21e-22	108	377	140	394	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50893.1|GH28|3.2.1.15	1.69e-274	1	380	1	380
EAA66950.1|GH28|3.2.1.15	1.69e-274	1	380	1	380
BCS18238.1|GH28	1.62e-210	1	379	1	379
APZ75903.1|GH28	9.86e-205	14	379	14	380
QKX54294.1|GH28	2.83e-201	19	380	20	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IA5_A	9.67e-144	39	378	4	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1NHC_A	1.68e-136	39	378	3	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	5.12e-135	35	378	7	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	5.12e-135	35	378	7	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	3.64e-133	38	378	2	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ATQ3|PGLR_EMENI	2.99e-275	1	380	1	380	Endopolygalacturonase AN8327 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN8327 PE=1 SV=1
sp|Q4WR80|PGLR_ASPFU	6.26e-189	5	378	5	378	Probable endopolygalacturonase AFUA_1G17220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_1G17220 PE=3 SV=1
sp|B0XPA1|PGLR_ASPFC	6.26e-189	5	378	5	378	Probable endopolygalacturonase AFUB_016610 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_016610 PE=3 SV=1
sp|A1D145|PGLR_NEOFI	5.12e-188	5	378	5	378	Probable endopolygalacturonase NFIA_008150 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_008150 PE=3 SV=1
sp|O42809|PGLRE_ASPNG	6.91e-155	14	378	14	378	Endopolygalacturonase E OS=Aspergillus niger OX=5061 GN=pgaE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999763	CS pos: 19-20. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in AN8327-T-p1.