CAZyme Information: AN8135-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN8135-T-p1
• CAZy Family: GT2
• CAZyme Description: Ortholog of Aspergillus versicolor : Aspve1_0089071 and Aspergillus sydowii : Aspsy1_0109832

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	ChrII_A_nidulans_FGSC_A4|CGC28	59042.53	8.3085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:861861-863627(+)

Full Sequence      

MHIAFLSNPASGELNVQLTTAEQLVAQGHTVTFLSAESGRVKIDRFRDARPPCAQARIRF
ISLGSGHTVNDVTPFIQERMHLMRRVPGDPVSLQTCIECALGPAEEHASTAIKVRKHLDA
LEPDMICVDALSPSCITGTRLSRRKFILTIPCSPGLSALPGPLDPHVVAWNRRGSWGTFF
ENLYLSLSESIHSRIHRDRRDKHKIIKRLGLKSYGATRDSAHFPPHWEDDKCVAGIHFNT
PGMIDCPKQSSKFVFVGAGVSKEPELLTATFPELEWMDDAALHGHDVVYINMGSMFVWES
DEFRACIKGFEAAHRNMGGRVRFLIKINGCPRSRHTPRHSTTITTGLSPDQKEVKLEDEL
PPYIRLTSWIQHQQSIYTHRALKAFVHHGGGNSFNEAVHFAIPQLVLSQWLDTHEYGLYA
EKFGLGLRSRNPPRIEADDIRLKIETLLGPKWDEYKSNCRAWAFRSQIAGGPAAAAKIVL
FHAENEQKIPTKRVSNATDSGMEMELTPPLSPVLGEKNGTGSGAVKEIVI

Enzyme Prediction     

No EC number prediction in AN8135-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	151	479	4.7e-16	0.6596858638743456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.65e-33	1	482	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.87e-12	1	488	2	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	3.15e-05	274	462	268	442	limonoid glucosyltransferase
177813	PLN02152	8.06e-05	248	476	194	443	indole-3-acetate beta-glucosyltransferase
223071	egt	0.001	360	445	344	427	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58772.1|GT1	0.0	1	530	1	485
BCS27825.1|GT1	4.88e-237	1	530	1	554
ATY63993.1|GT1	3.87e-164	1	484	1	474
SJX63359.1|GT1	2.49e-117	1	489	1	577
CDU26159.1|GT1	5.09e-117	1	489	1	577

PDB Hits     

AN8135-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	3.38e-120	1	500	1	584	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	1.12e-118	1	500	1	587	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	3.38e-08	359	444	346	434	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A0M4KE44|CGT_MANIN	8.75e-06	274	449	263	427	UDP-glycosyltransferase 13 OS=Mangifera indica OX=29780 GN=CGT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000001

TMHMM  Annotations     

There is no transmembrane helices in AN8135-T-p1.