CAZyme Information: AN7812-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7812-T-p1
• CAZy Family: GT1
• CAZyme Description: Putative versicolorin B synthase with a predicted role in sterigmatocystin/aflatoxin biosynthesis

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		69850.61	4.7884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:2750717-2752727(-)

Full Sequence      

MPAWSLLVLSALPVVGMFAGQTTFFSSPWETLFGTAAEQHEAAMDGRIQGRGLLSSHFGW
YGWPGQTFDYVIVGGGTAGLAMAHRLSEDGSNSVAVIEAGGFYEIEAGNATEVPMFLFNY
FFDNGHVKNPLFDWYQYTEAQPGLAGRKMFYMQGKTLGGSTARGAMLYHRGSKGAYQLWA
DRVGDDSYTWDNWLPFFKKSVQFSGPLTNPRPANATASNDVSAFAATAEEEGPVQVAYPY
LTNAISSWVDKALEKMGFPEAQGFSNGQLLGRSYITHTIHPKTRRRDTASTSYLQTALRT
SNSLNVITHTLVKKIDFDEEKRATGVVVNTGGFEWQIGAKKEVILSAGVMRSPQLLMVSG
LGPRETLEKLDIPVLSDLPGVGQNMQDTIILGPTNPVKVESHSQLMGSKETLPRSIYEYN
NFRTGLLTNPGQDYFAFEKHQPGNLSEATAADIDKAFPADWPTFSYIALDDTFVPQYDGK
NYFSMSAALLATFSRGTVTINTTNTADNPVVDPRWLDDPRDKEMAVAAFRRCREIVASET
MQQVIDGPELLPGFEYQTDEEILNYIAETSDAYYAGVGTCAMGKPDDPLAVLDSKARVRG
VKGLRVVDASAFPFAIDGQPMATVYALAEKVAADIIAGN

Enzyme Prediction     

No EC number prediction in AN7812-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	66	636	1.4e-169	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.00e-99	66	639	4	534	choline dehydrogenase; Validated
225186	BetA	1.07e-90	67	639	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.64e-41	493	630	2	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.99e-26	55	624	43	565	Protein HOTHEAD
366272	GMC_oxred_N	3.30e-25	146	387	16	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61600.1|AA3_2	0.0	1	639	1	616
QFQ50482.1|AA3_2	0.0	1	639	1	633
BCS19620.1|AA3_2	0.0	1	639	1	639
VBB75829.1|AA3_2	0.0	31	639	40	645
CDP25743.1|AA3_2	0.0	31	639	40	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	5.73e-60	66	636	4	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YS2_AAA	5.03e-56	65	633	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.52e-55	65	633	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.52e-55	65	633	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	3.35e-55	65	633	21	574	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A4UHS8|VBSA_DOTSE	0.0	5	639	5	647	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|C8VDT4|STCN_EMENI	0.0	1	639	1	639	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1
sp|M2Y151|VBSA_DOTSN	0.0	5	639	5	647	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1
sp|Q12062|AFLK_ASPPU	0.0	9	639	11	643	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	6.00e-150	10	635	6	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.010223	0.989768	CS pos: 19-20. Pr: 0.8994

TMHMM  Annotations     

There is no transmembrane helices in AN7812-T-p1.