CAZyme Information: AN7794-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7794-T-p1
• CAZy Family: PL1
• CAZyme Description: Has domain(s) with predicted chitin binding activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		32105.16	4.2751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:2713006-2714263(+)

Full Sequence      

MNKSRTSTDGNCGSNSETNATCLNSTFGNCCSSKGYCGSTTAYCGEGCQLEFGTCNDASV
QTVSTTGSCGATLTSNVTCLGSEYGDCCSRMGYCGGNSSYCGDGCQSEFGSCDPSSSTSS
SISSSTASSSASANPNLLANLTGTGDPDSEQGVDGGLSTGAIAGISVGSAVGGLAILALL
GWFFFMRRRRSTPVPEPDYKKDPSQMESVVVMGHEIAGEGAPMHEMDGQQTHEMEAKIEV
YYFRTSQALAQYPSEPAYEILASMDDIDRVLGSRSSSCRDKKTGGQYESVDHGSRPPYIQ
YDALSICI

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	6.50e-11	12	56	2	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	6.58e-10	68	113	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	2.12e-06	11	49	1	35	Chitin recognition protein.
211311	ChtBD1	3.26e-05	12	49	2	35	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	1.95e-04	85	107	14	36	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61582.1|CBM18	4.31e-128	1	240	1	240
BCS29742.1|CBM18	9.46e-56	6	237	4	203
UPK94823.1|CBM18	4.48e-39	6	112	37	144
QGI78660.1|CBM18	1.02e-38	3	118	36	152
QGI61474.1|CBM18	1.02e-38	3	118	36	152

PDB Hits     

AN7794-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN7794-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997675	0.002353

TMHMM  Annotations     

Start	End
162	184