CAZyme Information: AN7646-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7646-T-p1
• CAZy Family: GH95
• CAZyme Description: Protein with pectate lyase activity, involved in degradation of pectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	ChrIV_A_nidulans_FGSC_A4|CGC7	35127.37	4.2519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:2244464-2245716(+)

Full Sequence      

MQNLKFLIAAVSCLGPALAAPTPTSNFINSNFNKRASVEDSAFGYASLNGGTTGGAGGTT
TTVSSYAEFTAAVQGDDPKIVIVSGPIEETAEQVDVGSNTSILGADSSAVLTGFGLRLKE
VENVIIRNLGIAKVLADNGDAIGAEYSNNIWIDHVDVSSDRDHDKDYYDGLLDFKRGSDY
ITVSNSFIHDHWKASLVGHSNSNEDEDSGKLHVTYANNYWYNLNSRAPSIRFGTGHIYNN
YYETVSDGINTRIGAQVLVEGNVFVDSKKALYSTDEGYAVERNNDFGDAKNEALEGTLTS
VEYEYDLLDTSEVKSAVVGTAGQTLTF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	82	264	1.9e-86	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.81e-65	90	268	8	190	Amb_all domain.
226384	PelB	3.72e-52	63	322	59	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	4.30e-38	93	264	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50889.1|PL1_7|4.2.2.2	8.39e-230	1	327	1	327
CAW70629.1|PL1_7|4.2.2.2	8.39e-230	1	327	1	327
CAW61463.1|PL1_7|4.2.2.2	8.39e-230	1	327	1	327
EAA61832.1|PL1_7|4.2.2.2	8.39e-230	1	327	1	327
CBC59776.1|PL1_7|4.2.2.2	8.39e-230	1	327	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	3.36e-45	44	322	6	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.26e-38	44	242	10	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1OOC_A	8.27e-34	44	264	16	287	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	5.99e-33	44	264	16	287	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
3ZSC_A	1.51e-28	37	264	1	226	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AVN4|PLYA_EMENI	1.49e-230	1	327	1	327	Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyA PE=1 SV=1
sp|A2QV36|PLYA_ASPNC	6.97e-166	1	327	1	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	9.89e-166	1	327	1	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1
sp|Q4WIT0|PLYA_ASPFU	4.10e-155	4	327	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|B0XT32|PLYA_ASPFC	2.36e-154	4	327	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999665	CS pos: 19-20. Pr: 0.9848

TMHMM  Annotations     

There is no transmembrane helices in AN7646-T-p1.