CAZyme Information: AN7548-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7548-T-p1
• CAZy Family: GH92
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu2g14740, A. niger CBS 513.88 : An15g03570, A. oryzae RIB40 : AO090026000805, Aspergillus wentii : Aspwe1_0118903 and Aspergillus sydowii : Aspsy1_0045980

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		51760.69	6.5083

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:1917216-1918683(+)

Full Sequence      

MLGSKSHSLTLRFLGAGAALSLTLLTLLVFRRPSYFGHGGSGPYTPIDPASTTTQVYQGS
TTRTSGETGVNDTQQSRWEFNVHRDGDKHGLSESECSLAFPKLFTELERTAEFWASNGGI
SYGDVDDIARGGGIDGNGNGLVRAAVKDGELYIIDYGPQPYTFTRGKATLHSLHRALSSY
PDRHSLPDIEFVLTTDDFSTRTSTNPSPIWAYTKRQEDEDAAIWLMPDFGYWSWPEVDTV
GEYKDVRRRIFAKEEGLPFSDKKKQLLWRGSVSANPEIRKALLDTVGGKSWANVKEISWA
DSRFQPNSKSNPSDNEVLPIEDHCTYAFLVHTEGRSFSGRGKYLLNCKSVFITHKLTWLE
AHHSALVSSGPDANYVEVDRDWSDLERKVEFLLDNPQSAERIAENSVKTLRDRYLTPAAE
SCYWRALVRKYGEVSQFAPILEKGRTGEKTRGSRFESWVLGV

Enzyme Prediction     

No EC number prediction in AN7548-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	186	436	6.6e-28	0.988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	5.41e-26	101	444	7	332	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.17e-18	186	437	2	255	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD61446.1|GT0	8.84e-162	4	461	4	437
BCS30108.1|GT0	3.31e-161	12	460	12	443
BCS13796.1|GT0	1.34e-159	12	460	12	439
BCS02108.1|GT0	1.34e-159	12	460	12	439
QMW29784.1|GT0	9.31e-157	4	461	4	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.11e-12	186	444	94	351	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	5.44e-14	181	437	132	391	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	6.96e-12	186	444	122	379	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	7.28e-12	181	437	133	390	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	2.90e-10	186	433	122	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.86e-10	186	444	122	379	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
13	30