CAZyme Information: AN7541-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7541-T-p1
• CAZy Family: GH88
• CAZyme Description: Cutinase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	ChrIV_A_nidulans_FGSC_A4|CGC5	26074.18	5.0109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:1887064-1887937(+)

Full Sequence      

MHFKLLSLAALAGLSVASPLNLDERQLGSSSGNDLRDGDCKPVTFIFARASTEPGLLGMS
TGPAVCNDLKADASLGGVACQGVGPKYTAGLAENALPQGTSSAAINEAKELFELAASKCP
DTRIVAGGYSQGTAVMHGAIPDLSDEIKDKIAGVVLFGDTRNKQDGGQIKNFPKDKIKIY
CATGDLVCDGTLVVTAAHFTYVANTGEASKWLEQQLASMPASTSTSSSSSSSSSAPASQT
SQSSGLSSWFSGLGN

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	40	216	2.4e-43	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	9.66e-60	40	216	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50887.1|CE5|3.1.1.74	2.36e-168	1	255	1	255
EAA62121.1|CE5|3.1.1.74	6.98e-166	1	255	1	257
BCS30115.1|CE5	4.04e-123	1	218	1	215
BCS15815.1|CE5	2.35e-102	4	223	2	219
CAK48244.1|CE5	2.72e-101	8	223	7	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	5.39e-92	18	216	1	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.42e-88	30	216	2	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	3.95e-85	18	217	1	199	Chain A, cutinase [Malbranchea cinnamomea]
1CUY_A	9.27e-57	22	222	10	213	Chain A, CUTINASE [Fusarium vanettenii]
1CUG_A	3.72e-56	22	222	10	213	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AVY9|CUTI2_EMENI	4.20e-169	1	255	1	255	Cutinase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut2 PE=1 SV=2
sp|A1CVT3|CUTI2_NEOFI	3.55e-103	1	218	1	214	Probable cutinase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_102190 PE=3 SV=1
sp|B0Y537|CUTI2_ASPFC	1.39e-102	1	218	1	214	Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_071270 PE=3 SV=1
sp|Q4WQV2|CUTI2_ASPFU	1.39e-102	1	218	1	214	Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G14120 PE=3 SV=1
sp|A5ABE6|CUTI2_ASPNC	4.82e-102	8	223	7	219	Probable cutinase 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An11g00110 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000270	0.999689	CS pos: 25-26. Pr: 0.9606

TMHMM  Annotations     

There is no transmembrane helices in AN7541-T-p1.