CAZyme Information: AN7534-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7534-T-p1
• CAZy Family: GH88
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu1g01380/och4, A. niger CBS 513.88 : An14g07140, An12g07020, Aspergillus versicolor : Aspve1_0085820 and Aspergillus clavatus NRRL 1 : ACLA_033030

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	ChrIV_A_nidulans_FGSC_A4|CGC16	41766.58	5.1068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:1866784-1867923(+)

Full Sequence      

MASLMVSSSRYVAAIVVFLLIFNMYLFHRVIRLNTKNESLEMSLQTSLPAAITSKIDSAT
VTVTATVTATKTINAEKTANAPAPANGLKSQPDEDTTTGIKALLAHEASPTFPAKIWHKC
GPKGVNEHAQKLMDLWLEKNPHFRHELLTDESADQYVRENYADWPDVLETYMALQVPILK
ADFLRVLILYADGGIWSDLDVQDEVPVSEWIPEKYTEDTEHPVNVVVGIEFDGWQFTSWT
IMAKPHLLHFKNVIEYVVKQLKTTAIENHVSLSQVTKAMVGEVVAVTGPQAITMALLQSV
SEETGQDITKQHIRQLKEPKLLGDILVLPQAAFAALQGGNPTDQGPYLVSHQYAGSWKND
VGGEEGQNPPAPKETAASS

Enzyme Prediction     

No EC number prediction in AN7534-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	129	213	1.6e-19	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.47e-22	89	255	64	241	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.38e-12	127	213	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62114.1|GT32	3.31e-260	1	379	1	379
BCS30122.1|GT32	5.85e-190	1	379	1	378
QQK40626.1|GT32	7.07e-101	90	364	71	341
CAP80736.1|GT32	1.04e-97	90	364	71	341
CAK40793.1|GT32	7.39e-92	14	366	7	352

PDB Hits     

AN7534-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	1.26e-26	88	359	105	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	1.16e-25	112	360	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.26e-24	90	360	76	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	7.36e-13	100	245	84	270	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	4.16e-06	102	200	38	140	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
10	27