CAZyme Information: AN7267-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7267-T-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, oxidoreductase activity, acting on CH-OH group of donors activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	ChrIV_A_nidulans_FGSC_A4|CGC10	59198.84	5.9198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:485029-486678(+)

Full Sequence      

MTIPEFDYIIVGGGLTGCVVASRLKQHDPSLNVLLLEAGVDPSNNPNVKTYPPLFSLLGS
DIDWKYSTTPQPNTGNRIHSVHAGKALGGGTTINFGGWSRGDSADYDLWARTVRDQRWGY
QGLLPYFRRSESFFDRTADVQEHGFEGPVRVCAVSASDPNRQYPMRGPVRDAWIEIGEQY
NPAPGTGRLSGVVEFLETWQGGERQAAHQAYSLDGLQCITGARAHKVEVSGPGNIVSGVL
LADGRRFTARKEVILAAGALRTPQLLMLSGIGPGDTLAKHGISSVVEAPEVGRNLIDHFA
LYQLYKLREPERGIALGSSKLSHPALTQGFPVDWAVNQRVPRDVLDPAVQKDKERFGSST
DESVLIPGRPLVETLILYAPIGMPTDGSLLMTSVMLLSATSRGTVSISSASPSDPPLVDS
NYYDTETDRAVLTYGSRRTAKALLETSALKNYVECEVPPPDMPALTSQSSDEEFDARIRA
TGMAHHHPAGTAAMGKVVDTELRVIGVRNLRVVDASILPVSIGGHPQATLYAVAEQAADL
ILQADVEKA

Enzyme Prediction     

No EC number prediction in AN7267-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	543	5.4e-143	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.89e-96	1	542	1	532	choline dehydrogenase; Validated
225186	BetA	5.39e-92	4	542	6	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.15e-40	400	537	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.54e-34	72	298	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.52e-29	6	530	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61138.1|AA3_2	0.0	1	549	1	549
BCS24209.1|AA3_2	2.84e-304	1	542	1	548
QMW27401.1|AA3_2	3.20e-281	5	547	7	556
QMW39472.1|AA3_2	3.20e-281	5	547	7	556
QRD81789.1|AA3_2	3.20e-281	5	547	7	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.00e-65	1	541	1	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	3.70e-57	5	541	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6XUT_A	1.10e-55	6	541	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
3Q9T_A	1.20e-55	5	541	6	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.66e-55	5	541	6	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.73e-121	6	542	5	519	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	4.17e-64	5	541	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P9WMV5|Y1279_MYCTU	3.34e-59	5	541	4	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	3.34e-59	5	541	4	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P64264|Y1310_MYCBO	3.34e-59	5	541	4	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999932	0.000089

TMHMM  Annotations     

There is no transmembrane helices in AN7267-T-p1.