CAZyme Information: AN7158-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN7158-T-p1
• CAZy Family: GH71
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolase activity, acting on ester bonds activity and role in lipid metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	ChrIV_A_nidulans_FGSC_A4|CGC17	37625.65	5.0400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIV_A_nidulans_FGSC_A4:831065-832243(-)

Full Sequence      

MRAPITVSTTPGPAFLSRVSVGILLLLTFLTTASAASAIPALSTASLPEVTQQQHEDEYD
LQPRSTKPFLLRVMPLGASITVGYMSSDENGYRKYLREQLRYAGWGVDMVGSLANGTMKD
NQNEGHFGDTIDHIAEAAVNSTRLQPNVILINAGTNDCFQNIEINDADTRLDALITHLFA
SIPNTTIILSTLLPNEFASRAVRRVSQEYRNLVARRRSRGDRLVLAEMSYFITNDQLVDG
THPSDTGYKMMAAVWWSAIQTAEKEGKLSAPNIVTKSVLKDLVGINGTAQTEGKGLDDGP
VEDPQLPEYNAPGQPGGSGGEGGAVALGSGLRVKLGLGMVGLWIVCEFF

Enzyme Prediction     

No EC number prediction in AN7158-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	71	259	3.9e-76	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.15e-55	71	259	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	5.61e-16	76	249	2	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.33e-15	76	258	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	6.17e-08	73	252	1	221	GDSL-like Lipase/Acylhydrolase.
239947	SGNH_hydrolase_YpmR_like	1.26e-06	76	252	5	198	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA61410.1|CE3	1.60e-227	1	347	60	449
BCS30471.1|CE3	2.15e-119	24	316	22	305
CAP86338.1|CE3	1.91e-79	61	315	43	289
BAE62547.1|CE3	5.20e-75	44	284	24	263
UDD56943.1|CE0	1.06e-68	44	299	24	295

PDB Hits     

AN7158-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN7158-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003350	0.996628	CS pos: 35-36. Pr: 0.9720

TMHMM  Annotations     

Start	End
21	43