CAZyme Information: AN6929-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6929-T-p1
• CAZy Family: GH6
• CAZyme Description: Putative alpha-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		72780.72	6.2976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:3608393-3611360(+)

Full Sequence      

MSMINISHVNRLWKRRDAMEGGAAKMSPLYRFVVILLAACIAVVDGSSPDAIQMEAKYSE
ARSGLDEPLADGPWTFSNGLANSFRVETFNITRPGHVEPFFQQDGQRWQRLRLLNNDTTV
RVCGVGIRSLNEWTEVEQLPGYFASSNPLYNEIWALGAGTLQQACIEKGTALTTWEVAPD
GVLLRGQQSAQSALGTSLANYDISYGAYLLLPLSFDVKDGEWLHISTKITPNGYIVSINN
KTTIAVLFNELHLVTSAQFSAGSPYAGVMVHSRNGTLLYHNAMKNESVLEDSVCLDGAKG
DRLVWSGDFAHTQRIISASTNRSDLIKRTLEFILDRQEESGPSTGLLAMSPGMGLAAKLA
SLYNSYRLLDYQMLYLNSLARYYLDSADIKFIRAFFVGDSNGTAASALLAYTLTRMAEVA
ELVGKPDTANRWKERATDLSLAVNQQLWNKSLGTYNSSLTASTSQADSSIAALSTLRLGL
DTKRPLILPQTRQRTSLRMVSGFLLEALFKRARGQPHHAAIVETIDVLLSGLWAAMTDQD
EYYTGTSWEYLYPDGRPGLDLFTSPHSWGEAPTYVFTEYLLGIQPTSPGFMEWAFRPVIT
GMGLSWVEGRVPTPRGSINAGWAVENVTEIRLHLTIEFSRKVVSMLMFEVGSARTSQCL

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	400	636	1.1e-36	0.45634920634920634

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	6.42e-09	582	636	1	53	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	2.35e-05	405	461	171	228	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19496.1|GH78	2.75e-241	51	634	75	796
BCR89915.1|GH78	1.70e-190	53	636	82	802
BCS14345.1|GH78	1.78e-178	51	632	97	815
ANZ93894.1|GH78|3.2.1.40	1.15e-175	44	632	112	836
QKX55266.1|GH78	1.61e-165	51	624	77	802

PDB Hits     

AN6929-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN6929-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.201659	0.798333	CS pos: 46-47. Pr: 0.4812

TMHMM  Annotations     

There is no transmembrane helices in AN6929-T-p1.