CAZyme Information: AN6819-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6819-T-p1
• CAZy Family: GH54|CBM42
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	ChrI_A_nidulans_FGSC_A4|CGC12	32026.90	4.0478

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:3275792-3276790(+)

Full Sequence      

MSSLLKISIILAGMAAAQNTECGCYSTDGVTAATYTNRIYHDFRSLDETGTLYTGEPANV
TNDDESAAAPVQSGYLTSDGFVNDFGIQTWGSPASEDTPLRKQYSNANVYIEHDGSSSST
HLTLRSYRNADFVSTAEIDSKLQNIFHASITVRARVRGAAGACAGIFTYLDDKTESDIEI
LTRDPTNHIRYTNQPGLDSDGNEIPGASTDAVLPNGAVWTDWVDHRLDWTPELSAFYANG
ELVETKTYGIPDAPSSFIVNLWGDGGSWSGTPDIESAAYLDIQWIEVLFNTSDASA

Enzyme Prediction     

No EC number prediction in AN6819-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	84	287	6.1e-80	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.87e-52	79	287	7	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.39e-07	151	285	70	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58218.1|GH16_22	1.50e-221	1	296	1	296
BCS21543.1|GH16_22	2.54e-152	1	293	1	290
CCT66306.1|GH16_22	8.75e-72	9	292	1	290
QKD50890.1|GH16_22	4.88e-71	5	292	10	303
CEF84700.1|GH16_22	1.00e-70	19	292	26	306

PDB Hits     

AN6819-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN6819-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000322	0.999631	CS pos: 17-18. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in AN6819-T-p1.