CAZyme Information: AN6786-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6786-T-p1
• CAZy Family: PL1
• CAZyme Description: Putative beta-1,4-endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	ChrI_A_nidulans_FGSC_A4|CGC7	25018.41	6.3532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:3163474-3164261(-)

Full Sequence      

MHCTFSAFVASVATLVAPALAALATTTHYSDGLQGACGCGNKIGTYDWSYGIANKVYTAA
ANQALFDSGPNDATHWCGNGCGKCYRLTSTGVSTCETCGAGGEQGKSIVVMVTNLCPFKG
NERWCPNPGQLNPHGYAYHFDIMGGAGVFGDNVVVEFEEVPCPGDAAFKWAACECHPNLR
NKDLTLNAGAHAAGSKIVGPAQAAIISVNGLPAPAAMAVQPPPPPPPPAPARPAIEIPPP
PAPV

Enzyme Prediction     

EC	3.2.1.4:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409015	DPBB_GH45_endoglucanase	1.62e-31	29	162	12	149	double-psi beta-barrel fold of glycoside hydrolase family 45 endoglucanase EG27II and similar proteins. This group is made up of endoglucanases from mollusks similar to Ampullaria crossean endoglucanase EG27II, a glycoside hydrolase family 45 (GH45) subfamily B protein. Endoglucanases (EC 3.2.1.4) catalyze the endohydrolysis of (1-4)-beta-D-glucosidic linkages in cellulose, lichenin, and cereal beta-D-glucans. Animal cellulases, such as endoglucanase EG27II, have great potential for industrial applications such as bioethanol production. GH45 endoglucanases from mollusks adopt a double-psi beta-barrel (DPBB) fold.
409008	DPBB_EXP_N-like	4.50e-11	28	162	7	117	N-terminal double-psi beta-barrel fold domain of the expansin family and similar domains. The plant expansin family consists of four subfamilies, alpha-expansin (EXPA), beta-expansin (EXPB), expansin-like A (EXLA), and expansin-like B (EXLB). EXPA and EXPB display cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. EXPA proteins function more efficiently on dicotyledonous cell walls, whereas EXPB proteins exhibit specificity for the cell walls of monocotyledons. Expansins also affect environmental stress responses. Expansin family proteins contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This family also includes GH45 endoglucanases from mollusks. This model represents the N-terminal domain of expansins and similar proteins, which adopts a double-psi beta-barrel (DPBB) fold.
409011	DPBB_EXPA_N	3.87e-10	30	141	16	103	N-terminal double-psi beta-barrel fold domain of the alpha-expansin subfamily. Alpha-expansins (EXPA, expansin-A) have cell wall loosening activity and are involved in cell expansion and other developmental events during which cell wall modification occurs. They also affect environmental stress responses. Arabidopsis thaliana EXPA1 is a cell wall modifying enzyme that controls the divisions marking lateral root initiation. Nicotiana tabacum EXPA4 positively regulates abiotic stress tolerance, and negatively regulates pathogen resistance. Wheat TaEXPA2 is involved in conferring cadmium tolerance. Alpha-expansins belong to the expansin family of proteins that contain an N-terminal domain (D1) homologous to the catalytic domain of glycoside hydrolase family 45 (GH45) proteins but with no hydrolytic activity, and a C-terminal domain (D2) homologous to group-2 grass pollen allergens. This model represents the N-terminal domain of alpha-expansins, which adopts a double-psi beta-barrel (DPBB) fold.
215097	PLN00193	2.83e-06	30	162	44	158	expansin-A; Provisional
129070	DPBB_1	4.42e-04	58	135	1	55	Rare lipoprotein A (RlpA)-like double-psi beta-barrel. Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58604.1|GH45	3.72e-142	36	244	39	247
QYT05581.1|CBM1|GH45	1.67e-68	15	185	11	177
QGA19871.1|CBM1|GH45	3.58e-68	7	176	3	169
AGW24295.1|CBM1|GH45	6.71e-68	15	176	12	170
ACF33814.1|CBM1|GH45|3.2.1.4	6.71e-68	15	176	12	170

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBU_A	1.50e-34	24	176	25	181	Crystal structure of GH45 endoglucanase EG27II in apo-form [Ampullaria crossean],5XBX_A Crystal structure of GH45 endoglucanase EG27II in complex with cellobiose [Ampullaria crossean],5XC4_A Crystal structure of GH45 endoglucanase EG27II at pH4.0, in complex with cellobiose [Ampullaria crossean],5XC8_A Crystal structure of GH45 endoglucanase EG27II at pH5.5, in complex with cellobiose [Ampullaria crossean],5XC9_A Crystal structure of GH45 endoglucanase EG27II at pH8.0, in complex with cellobiose [Ampullaria crossean]
5XCA_A	2.33e-33	24	176	25	181	Crystal structure of GH45 endoglucanase EG27II D137A mutant in complex with cellobiose [Ampullaria crossean]
1WC2_A	2.46e-20	24	165	17	160	Chain A, ENDOGLUCANASE [Mytilus edulis]
3X2L_A	1.73e-11	38	162	20	142	Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2M_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2N_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],5KJO_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],5KJQ_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium]
3X2G_A	8.60e-11	38	162	20	142	Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2H_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium],3X2I_A Chain A, Endoglucanase V-like protein [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43317|GUN5_HYPJE	3.88e-64	24	175	20	168	Endoglucanase-5 OS=Hypocrea jecorina OX=51453 GN=egl5 PE=3 SV=1
sp|P82186|GUN_MYTED	1.27e-19	24	165	17	160	Endoglucanase OS=Mytilus edulis OX=6550 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999731	CS pos: 21-22. Pr: 0.9800

TMHMM  Annotations     

Start	End
7	29