CAZyme Information: AN6748-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6748-T-p1
• CAZy Family: GH51
• CAZyme Description: Putative pectate lyase with a predicted role in pectin degradation

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	ChrI_A_nidulans_FGSC_A4|CGC2	26739.71	3.7395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:3052620-3053463(+)

Full Sequence      

MPVLSKLLPTLTLTLPLLAGPCLAAANPKLSKRFTFPIPSSTGSVTFSEPYEIAAGEIYD
GELQTFGRGVECTGQDEGGESDTVFIVQEGGTLKNAIIGADQIEGVYCLGACTIENVWWE
KVCEDALSLKEGSGPYVVTGGGAQGAEDKVIQHNSEGEVIVDGFTVYDFGKLYRSCGTCG
DIQRSATITNVVAVSGSTIAGANGNFGDVVTIDSSNCATDVSAICTTYEADADGGEPEEV
STDVTEACVFEELPACE

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	41	229	1.2e-71	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	7.64e-98	35	229	1	194	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58566.1|PL3_2	1.99e-186	1	257	1	257
BCS28578.1|PL3_2	7.74e-153	1	257	1	251
QMW26393.1|PL3_2	2.75e-109	36	256	21	242
BAE55530.1|PL3_2	2.75e-109	36	256	21	242
QMW38472.1|PL3_2	2.75e-109	36	256	21	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	2.02e-24	49	177	7	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3T9G_A	4.52e-20	38	177	1	139	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4EW9_A	6.16e-20	40	177	2	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
4Z03_A	3.91e-19	38	177	9	147	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	3.91e-19	38	177	9	147	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AY82|PLYG_EMENI	3.54e-187	1	257	1	257	Probable pectate lyase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyG PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	5.60e-122	12	252	5	241	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	7.32e-112	36	256	20	242	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	7.32e-112	36	256	20	242	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	3.15e-108	36	256	19	241	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000408	0.999592	CS pos: 24-25. Pr: 0.9755

TMHMM  Annotations     

There is no transmembrane helices in AN6748-T-p1.