CAZyme Information: AN6697-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6697-T-p1
• CAZy Family: GH51
• CAZyme Description: Putative Sun-family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		42931.20	4.3434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:2883489-2884829(-)

Full Sequence      

MKYSFALTLATAGSMAAAAQHQHGHHHQHSKREVVTVDGPTVVKYMLDNQLISAEKVCEG
ITDGTLAWANGQPPSDPCQASSTTSTEAYTPTATAAKFIETEASSSTATSTSTTVSVPSS
TTSQPAASSSSASTATGLDAPFPDGELDCSTFPSDYGAVPLDYLGLDGWSGIQYVTLVGE
IISDIITAVTGDSCTSGAMCSYACPPGYQKSQWPSTQGSTGQSVGGLQCKFGKLYLTNPD
LSDKLCIKGVGGVKAKNTLSDHVAVCRTDYPGTESETIPISLNSGETKEVTCPDGATYYK
WEGKTTSAQYYVNPAGTSQEEGCQWGDGSKPIGNWAPINLGVGENNGKWLSIFQNSPTTT
EKLDFNIKIQGDNLSGSCKYEDGSFISDTGSNDSGCTVQVMSGDATFVFY

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	103	410	2.2e-108	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.59e-135	144	397	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58515.1|GH132	1.20e-264	1	410	1	410
BCS28694.1|GH132	5.83e-185	1	410	1	415
BAE55477.1|GH132	1.24e-181	1	410	1	415
QMW38532.1|GH132	1.72e-179	1	410	1	416
QRD87446.1|GH132	1.32e-176	1	410	1	416

PDB Hits     

AN6697-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGL5|SUN1_ASPFU	2.93e-175	1	410	1	414	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|D4AM57|SUN41_ARTBC	1.28e-127	137	409	173	446	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|P46955|NCA3_YEAST	1.03e-81	139	410	78	337	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|O43015|YBOH_SCHPO	1.18e-81	139	410	56	319	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	9.63e-79	142	410	162	417	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000747	0.999226	CS pos: 18-19. Pr: 0.9838

TMHMM  Annotations     

There is no transmembrane helices in AN6697-T-p1.