CAZyme Information: AN6606-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6606-T-p1
• CAZy Family: GH5
• CAZyme Description: Ortholog(s) have mannosyl-oligosaccharide glucosidase activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		91925.85	4.6424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:2604066-2606871(+)

Full Sequence      

MHLSISSLLSAPLFCAAALAVQVSDGVSTVAHEAARASNESLLWGPYKPNLYFGVRPRIP
NSVFAGLMWAKVDNYATAQENFRHTCEQNEGMAGYGWDEYDVRKGGRETIHDAGNSLDLT
IDFVKVPGGQHGGSWAARVKGVPRDDALPDQPTTVVFYAGLEGLGSLGVSTESDDPRGFE
GDVKLDGFTAELGRFSIDVTAGPKTNEHPAYNHPSYDDKPLDRTIVSSFPVPPEHTWQTK
VLLFTQMKKAVDEAIQKYGAENPPPPAQVFTVNNSPGDGNVQLVQKVFSGAFEFDILFSS
GSAPEPLTSEILTAEIKSASLSFSERFKKILSPQSPFDSADYLEFSKSMLSNLIGGIGFF
HGSDIVDRSAAPEYDEENEGFWEETEEARSRAQPVLEGPKDLFTAVPSRPFFPRGFLWDE
GFHLIPILDWDPDLALEIVKSWFSLMDEDGWIAREQILGNEARSKVPPEFTVQYPHYANP
PTLFMVLEAFVDKLEAQDESTQTYLEDEGLHSVYVKHPKLGENFIRSIYPLLKKHYFWYR
STQYGDIKSYDREAFSTKEAYRWRGRSVQHILTSGLDDYPRAQPPHPGELHVDLISWMGM
MTRALRRIAETLGETEDIEEFKAYETAIERNIDDLHWDADAKTYCDATIDDYEDSVHVCH
KGYVSIAPFLTGIVGPDSPRLEAILDLIEDPEELWSDYGIRSLSKKDEFYGTAENYWRSP
VWININYLVLKNLYNIALTPGPQQNRARKMYSGLRKNLVENVYREWKNTGFAWEQYNPET
GKGQRTQHFTGWTSLVVKMMAMPDLPASEKTGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	589	800	6.5e-34	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	307	802	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.91e-131	42	265	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.83e-07	441	754	280	565	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	3.14e-05	592	800	578	779	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58135.1|GH63	0.0	1	816	1	749
BCS17840.1|GH63	0.0	1	816	1	818
UDD57712.1|GH63	0.0	1	816	1	817
QRD84190.1|GH63	0.0	1	816	1	817
CAL00956.1|GH63	0.0	1	816	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.50e-174	33	800	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.47e-136	42	801	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.50e-245	27	801	27	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.48e-173	33	800	36	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.37e-138	42	801	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	9.66e-134	42	801	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	9.59e-133	44	801	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.238304	0.761658	CS pos: 20-21. Pr: 0.3429

TMHMM  Annotations     

There is no transmembrane helices in AN6606-T-p1.