CAZyme Information: AN6534-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6534-T-p1
• CAZy Family: GH5
• CAZyme Description: Putative mannosylinositol phosphorylceramide (MIP2C) synthase with a predicted role in sphingoglycolipid metabolism

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		41379.69	8.5331

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:2401004-2402171(+)

Full Sequence      

MRRGLLVFLVVNLLIVTFLIRSVSTLLSLLLEDASADAIHRAELPSPNSSLIEQRPQKIP
KIIHQTYKNESIPEVWQEAQQSCIDLHPDYEYILWTNEKSRDFIAAEYPWFLDTFDNYKY
PIQRADSIRYFVLAHYGGTYIDLDDGCNRRLDPLLSYPAWVRRTAPTGISNDAMGSVPQH
PFFLRVIEMLQSYDRSWLLPYITVMYSTGPLFLSVIWKEYMAESPAEAARVRILMQDEYN
RFSWSFFTHHVGNSWHGKDARLIFWMGQHWMLLTVAGFVLAGAVGLCLWWAYGRLLLLGA
KYRYRYSKLPIPGLRLPSPSRRSRGMMPILLRRVSFKDEESGPTETSYEYVSRRD

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	5.7e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.51e-75	57	281	80	306	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.09e-26	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57874.1|GT32	3.20e-264	1	355	1	355
AAP47108.1|GT32	3.20e-264	1	355	1	355
BCS17906.1|GT32	4.39e-244	1	353	1	354
QMW44769.1|GT32	5.27e-225	1	355	1	358
BAE61832.1|GT32	5.27e-225	1	355	1	358

PDB Hits     

AN6534-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	4.03e-103	1	279	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.68e-103	1	279	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.47e-91	59	280	82	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.42e-87	48	279	46	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.43e-56	57	284	62	290	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.463526	0.536477	CS pos: 25-26. Pr: 0.2761

TMHMM  Annotations     

Start	End
5	27
270	292