CAZyme Information: AN6106-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN6106-T-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: Putative pectate lyase with a predicted role in pectin degradation

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	ChrI_A_nidulans_FGSC_A4|CGC1	24406.04	4.2813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:1237333-1238235(-)

Full Sequence      

MLSKLALASTLIPAALACLGYEGGVPTPTASYSNSAPIEIAAGQTFDAGWARYDRGSGAC
TDGEGGNDDAVFILRSGATLKNVIIGKNQKEGVHCEGPCTLEFVWFEDVCEDAITVRGDS
AGDHTWIIGGGAYHASDKIVQHNGCGTVNIINFYAEDYGKVYRSCGNCSSQCKRNVYIEG
VTAYDGGDICGINSNYGDTCTLNNVCTDADHPCVLYEGCAGGCEPEKVGYCSG

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	29	218	3.8e-90	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	8.87e-116	22	223	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58081.1|PL3_2	2.19e-176	1	233	1	244
BCS26321.1|PL3_2	4.13e-158	1	233	1	233
QMW46280.1|PL3_2	2.78e-138	1	233	1	234
QMW34226.1|PL3_2	2.78e-138	1	233	1	234
UDD63130.1|PL3_2	2.78e-138	1	233	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	4.57e-28	38	176	9	145	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	4.92e-21	38	182	14	152	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	5.03e-21	38	182	15	153	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	4.45e-20	38	182	23	161	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	4.45e-20	38	182	23	161	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B024|PLYF_EMENI	1.15e-180	1	233	1	233	Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyF PE=3 SV=2
sp|Q0CCF8|PLYF_ASPTN	4.83e-146	1	233	1	234	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1
sp|A1D5E3|PLYF_NEOFI	1.88e-143	1	233	1	234	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	4.94e-139	1	233	1	234	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2
sp|B0Y953|PLYF_ASPFC	7.01e-139	1	233	1	234	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006699	0.993264	CS pos: 17-18. Pr: 0.8989

TMHMM  Annotations     

There is no transmembrane helices in AN6106-T-p1.