CAZyme Information: AN5930-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN5930-T-p1
• CAZy Family: GH43
• CAZyme Description: Has domain(s) with predicted hydrolase activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		40673.60	6.4937

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrI_A_nidulans_FGSC_A4:1774124-1775473(-)

Full Sequence      

MLAATFILALMNGNSLTSALPFKPITRSRHGFDWDSTRNLIAFGDSYTFIQGTHGYPNYS
FIGDQLNYAYDARTLLTDKIVQNQTGTSAGGPNWVEFLTGCGLKEGLTSPISCTKQLWDF
AFAGAGVSAEHIPLHHPYTISLVNQIRQFTIYGHLVLTSSSQHPSHKATLSAAPILDPAS
TLTAIWIGINDINDSAKNSSISSFPDFYNTLLQTAFSGLQTLVSLGYKDFVDFVVLNLPP
LDRTPANQARTLRNETAAPDATQVGWFNSAITSQARRFGRRNPDTNVLVFDAHRVLSHVL
DFPDQYGIVNTTDFCPGYDQPDIETEYQAYGCPTSLGTYFWFNSGHITSRLHEILAAQLS
KTLERWRG

Enzyme Prediction     

No EC number prediction in AN5930-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	40	359	5e-95	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	8.63e-63	39	362	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.70e-13	120	359	80	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.12e-08	35	365	27	335	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	1.78e-04	182	356	105	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA57793.1|CE0	1.26e-278	1	367	1	367
BCS18123.1|CE0	2.21e-171	8	368	9	366
QRD91661.1|CE0	9.05e-147	8	364	7	336
UDD64353.1|CE0	9.05e-147	8	364	7	336
QMW35262.1|CE0	1.08e-146	8	364	12	341

PDB Hits     

AN5930-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2FKR1|AES1_THETO	8.21e-18	36	368	30	299	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|G2QJ27|AES1_MYCTT	2.08e-17	36	368	30	299	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000366	0.999598	CS pos: 19-20. Pr: 0.9709

TMHMM  Annotations     

There is no transmembrane helices in AN5930-T-p1.