CAZyme Information: AN5333-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN5333-T-p1
• CAZy Family: GH35
• CAZyme Description: Putative pectate lyase, involved in degradation of pectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		44904.93	3.8771

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:3119933-3121410(+)

Full Sequence      

MQPLHTLLALLPLCRSTTALLAFPGAEGFGANAVGGRGGDVYVVTNLEDSGEGSLRDAVS
ETDRIVVFAVGGVINIEDRLVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIRV
RMGRGGDSGKDGITIAEGSNMIFDHVSVSWGRDETFSISGTAENITVQDSIIAQGLETHS
CGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVVYNWGGGGGYIAGDSSGQSYAN
IVGNYFISGPSTSVTAFTRGNENFHGYVENNYYDPDQDGTLNGNELGVSSSNYGGMDIVD
TKYDYPAAQYIMTPDEAVSYVTENVGASLVRDGVDSNLIDQVLSYGTDGALISDEDDFGG
VGDLDGGETPTDTDGDGIPDDVETQLGTDPNIADSTEIDSSTGYSWLEVWANSLVPEGYA
STRKC

Enzyme Prediction     

No EC number prediction in AN5333-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	71	246	8e-55	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226384	PelB	6.40e-07	22	327	30	341	Pectate lyase [Carbohydrate transport and metabolism].
408654	TSP3_bac	1.93e-04	372	391	1	20	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
366158	Pec_lyase_C	0.003	78	220	28	190	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62493.1|PL1_2	1.67e-305	1	425	1	421
BCS17310.1|PL1_2	4.92e-273	3	421	4	422
UDD60834.1|PL1_2	1.50e-234	6	420	6	419
QRD90936.1|PL1_2	4.30e-234	6	420	6	419
QMW31873.1|PL1_2	4.30e-234	6	420	6	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	7.97e-07	14	222	35	251	VexL: A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B297|PLYC_EMENI	2.97e-306	1	425	1	421	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
sp|Q0CLG7|PLYC_ASPTN	2.39e-245	7	419	7	418	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
sp|B8NQQ7|PLYC_ASPFN	7.64e-235	6	420	6	419	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
sp|Q4WL88|PLYC_ASPFU	3.74e-233	7	419	8	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
sp|Q2UB83|PLYC_ASPOR	1.47e-232	6	420	6	419	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.360691	0.639285	CS pos: 21-22. Pr: 0.3555

TMHMM  Annotations     

There is no transmembrane helices in AN5333-T-p1.