CAZyme Information: AN5305-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN5305-T-p1
• CAZy Family: GH32
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		71256.13	5.4192

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:3204176-3206115(-)

Full Sequence      

MAFQQVPVRNVNITSAFWSQMRQCSKEKTIPAIIKAQKSLQHWYCLTWKEGHEIQPHPFW
DSDIYKIVEAACYFLMKDKDDELMATVEEAADMIRAAQHPDGYINSYYTVLGIDKRWTNL
RDMHELYCLGHLTEACVAYETLTNSGRLLEPVLKALRHVDSVFGAEPGKKRGYPGHQEIE
IGLLRLYELCGEPVLLKLAKYFISERGRRDTNGETYFDHEARARGGDPYDHFGSEMKAWF
QHPRDYSYNQADRPLVETTEVKGHAVRAMYYYIAATDLVRLTGDEEIKAALDRMWMDMTE
RKLYVTGGIGAMRQWEGFGAKYVLADTDESGICYAETCACFALIIWCQRMLQLDLDAKYA
DVMEVGLYNGFLGAVGLDGGSFYYQNPLRTYTGHPKERSEWFEVACCPPNVAKLLGSMES
LIYSFKDDLVAIHLYIESDFTVPETGVVVSQKTNMPWSGDVEISVKGTTALALRIPTWAE
GYSSSVQGEVKNGYLYIPHSQDLEVKLSFTLKARKLYPNPATEKDQICITRGPLVYCIED
VDNEVDIDHVGLVDGPVTDGEPIDIATVNDVIPVKATGRELVKGQNHLYASEPWKYGDKK
NLLYVPYFLRANRGGKGGMTVWAKRLEAS

Enzyme Prediction     

No EC number prediction in AN5305-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	11	537	4e-168	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	8.95e-139	54	625	58	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	3.80e-118	10	537	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF82133.1|GH127	0.0	1	629	1	629
BCS17261.1|GH127	0.0	1	626	1	626
QKX55775.1|GH127	8.99e-307	1	626	1	634
BCS17387.1|GH127	1.14e-302	1	628	1	632
UPK92605.1|GH127	8.90e-286	1	629	1	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.85e-126	10	622	15	644	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.42e-122	10	622	15	644	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.03e-91	6	622	10	622	The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	5.88e-88	10	625	2	658	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	7.58e-88	10	625	2	658	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	3.02e-87	10	625	2	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

There is no transmembrane helices in AN5305-T-p1.