CAZyme Information: AN5281-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN5281-T-p1
• CAZy Family: GH31
• CAZyme Description: Putative pyranose oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		67852.63	6.8520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:3279508-3281739(-)

Full Sequence      

MQYSRMTATRENPKYKNLRVEECDVLIIGSGPVGATYAREILDPGSGASPGRKAPKVIMV
ETGAQESKVPGEHKKNAVVYQKHIDSFVNVIQGSLFATSVPTRVDPNLKLPPVSWSPREK
QNFNGQNKEQNIYHNLDANGVSRNVGGMSTHWTCATPRQHELERSKIFDDATWDRLYKRA
EELIGTRTDVLDQSIRQRLVLDILRKKFKNRDAKALPLAAEKVEGKNLIKWSSSSTVLGN
LLEDEKFTLLDQHHCEKLEFNDETNKVSFAIIKNLAKPQTSKEDEDRLRIKAKYVIVCGG
PILTPQLLFKSGFRYDEEDAEDSEGNKSSLYIPALGRNLTEQTMCFCQIVLKDKWVEELQ
KNNWGPECEEHRRKYDEEDDPLRIPFDDLDPQVTLPFTENTPWHTQIHRDAFSYGAVPPA
IDKRTIVDLRYFGRAETQWRNRVTFSKKLTDAYGMPQPTFDFKLSTKDRLESHRMMQDME
KVAGELGGYLPGSEPQFLAPGLALHVCGTTAALRKGCRSEDEMKRISVCDENSKVWGVEN
LHLGGLNVIPGPRSNASNPTLTAMCFAIKGAEEIRRKLGKKGSHSGNRDDGDVDTDTDDD
A

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	578	3.8e-257	0.9981785063752276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	0.0	24	579	2	547	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
225186	BetA	1.31e-13	21	576	6	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.81e-09	440	569	4	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.30e-04	143	313	25	202	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF82183.1|AA3_4	0.0	1	601	1	601
QRD93534.1|AA3_4	4.26e-208	22	574	5	573
QMW46713.1|AA3_4	7.06e-205	22	574	6	596
QMW34644.1|AA3_4	2.23e-203	22	574	5	595
BAE56707.1|AA3_4	1.20e-202	27	574	39	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BG7_A	4.95e-121	24	578	48	613	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
2F5V_A	6.18e-121	24	578	20	585	Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus Peniophora sp. [Peniophora sp. SG]
2F6C_A	6.18e-121	24	578	20	585	Chain A, Pyranose 2-oxidase [Peniophora sp. SG]
3BG6_A	6.97e-121	24	578	48	613	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]
1TT0_A	6.97e-121	24	578	48	613	Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_B Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_C Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_D Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],2IGK_A Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_B Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_C Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_D Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_E Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_F Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_G Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_H Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	0.0	1	601	1	601	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q75ZP8|P2OX_LYOSH	9.66e-129	24	586	37	613	Pyranose 2-oxidase OS=Lyophyllum shimeji OX=47721 GN=p2ox PE=2 SV=1
sp|Q6UG02|P2OX_PHLGI	8.83e-121	22	578	46	611	Pyranose 2-oxidase OS=Phlebiopsis gigantea OX=82310 GN=p2ox PE=1 SV=1
sp|P79076|P2OX_TRAVE	1.81e-120	24	578	48	613	Pyranose 2-oxidase OS=Trametes versicolor OX=5325 GN=P2OX PE=1 SV=1
sp|Q8J136|P2OX_PENSG	7.12e-120	24	578	48	613	Pyranose 2-oxidase OS=Peniophora sp. (strain SG) OX=204723 GN=p2ox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AN5281-T-p1.