CAZyme Information: AN5231-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN5231-T-p1
• CAZy Family: GH31
• CAZyme Description: Putative exo-arabinanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	ChrV_A_nidulans_FGSC_A4|CGC9	40489.51	7.4435

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:1573148-1574251(+)

Full Sequence      

MPGHLGQKILSKIGLDDHRGHHGSSHGPSSRGPPLHVSRTVHEDERLVRSQPRGTYPRLA
KLSDGSILSACTCFDGPTRILHIGKSTDGGRHFEDFAEVTRGNGDVDNMYILEVAPNTVL
AAFRNHDLGPNGPTHFRITVCRSTDGGKSWRFLSQAAEKKPPHGIWEPFMRMGRQGEVML
TYSEEFAHNNQCTMLVRSTDGGATWSPPQCLEGKNDPYRDGMNGIAKTFDNGREALLMVF
ETTTFGTFNLEALISYDDGYTWGHRHRVYVPPRGHNAGSPQVASFGDGSLAVIFMTDEDH
SQVKWTRNASIKVVYGTPPNNGHIQWSPPAVICPHLSHWPGIMALDDRTLLATYECGGPK
VKSITLQ

Enzyme Prediction     

No EC number prediction in AN5231-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	52	314	4.7e-74	0.9153094462540716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	3.26e-14	57	360	17	328	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.08e-12	75	301	107	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	4.14e-04	138	309	20	194	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
404074	BNR_2	0.001	134	266	134	255	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62412.1|GH93	4.03e-289	1	367	1	367
BCS24955.1|GH93	6.37e-224	1	366	1	364
QMW42642.1|GH93	6.31e-188	1	366	1	378
QMW30589.1|GH93	6.31e-188	1	366	1	378
QRD89469.1|GH93	6.31e-188	1	366	1	378

PDB Hits     

AN5231-T-p1 has no PDB hit.

Swiss-Prot Hits     

AN5231-T-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000012

TMHMM  Annotations     

There is no transmembrane helices in AN5231-T-p1.