CAZyme Information: AN5214-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN5214-T-p1
• CAZy Family: GH31
• CAZyme Description: Endo-beta-1,4-glucanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	ChrV_A_nidulans_FGSC_A4|CGC5	36080.22	4.0660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrV_A_nidulans_FGSC_A4:1513716-1514994(-)

Full Sequence      

MKVNTLLVAVAAGTAMAAPQLKKRAGFTFFGVTEAGAEFGEKSIPGVWGTDYTFPDTESI
LTLISKGFNTFRIPFLMERLTPEMTGSFDEGYLKNLTSVVNAVTDAGAWAIVDAQNFGRF
NGEIISSASDFQTWWKNVAAEFADNKNVIFDTNNEFHDMDQTLVLDLNQAAINGIRAAGA
TSQYIFVEGNSYTGAWTWTDNNDNLKSLTDPQDKIVYEMHQYLDTDGSGTHETCVSETIG
AERVESATQWLKDNGKLGVIGEFAGGNNEICRAAVKSLLDALKENDDVWLGALWWAAGPW
WEDYMFSMEPTDGIAYTGMLSTLEAYMN

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	29	305	1.4e-110	0.9964539007092199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	6.11e-71	32	298	1	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.28e-24	27	328	45	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABF50872.1|GH5_5|3.2.1.4	6.28e-246	1	328	1	328
EAA62395.1|GH5_5|3.2.1.4	1.78e-242	1	328	1	334
BCS24926.1|GH5_5	1.32e-183	1	327	1	327
QRD88581.1|GH5_5	3.91e-170	1	327	1	332
BAE56461.1|GH5_5	3.91e-170	1	327	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	7.32e-164	27	327	2	302	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	6.44e-163	27	327	4	304	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	6.67e-163	27	327	5	305	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	1.42e-152	27	327	3	304	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	2.82e-150	27	327	4	305	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1HFS8|EGLB_EMENI	1.12e-246	1	328	1	328	Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglB PE=1 SV=1
sp|B8MW97|EGLB_ASPFN	6.95e-171	1	327	1	332	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
sp|Q2UPQ4|EGLB_ASPOR	6.95e-171	1	327	1	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	3.68e-168	4	327	5	332	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|A2QPC3|EGLB_ASPNC	2.14e-162	4	327	5	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000292	0.999668	CS pos: 24-25. Pr: 0.9579

TMHMM  Annotations     

There is no transmembrane helices in AN5214-T-p1.