CAZyme Information: AN4515-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN4515-T-p1
• CAZy Family: GH3
• CAZyme Description: Glycosidase CRH1, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		46797.22	3.9884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIII_A_nidulans_FGSC_A4:1803906-1805317(-)

Full Sequence      

MLRLQTALFFAYLAARSLAADDFTPPSCSLDEHCPKEYPCCSVYGQCGTGAYCLGGCDPL
MSYSLDSCAPMPVCESKSYKWENLDSAASNNEYLGNATESDWVYSGKLKVEDGNLVLTMP
KESTGSLIANNHYIWYGKIGAKIKSSRGAGVVTAFILLSDTKDEIDYEWVGSDLKEVQTN
YYFQGILDYDNGGKSKVDGGNTYADWHTYEIDWTPEKIDWLVDGEVVRTLTKESTFNETA
DRYEYPQTPSRMQLSLWPAGQASNAQGTIEWAGGEIDWDSEDIKNQGYYAAYYSDITVEC
YDPPSDAKVSGDVSYDFKDDKGLESSVEITDNNTVLASLGATGLNMDLGSNKTDSSGNST
GSISNSTVPQNQGGTGNIAGSSTGNGGSSSSDSSGGAFSQGTDDSTDGENAAPSERVLKG
SFFAVLVAVVVLIIM

Enzyme Prediction     

No EC number prediction in AN4515-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	104	277	1.6e-80	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.80e-104	91	302	1	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	8.91e-65	106	273	4	168	Glycosyl hydrolases family 16.
211314	ChtBD1_GH16	3.05e-25	27	72	2	47	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
185683	Glyco_hydrolase_16	2.21e-23	112	278	37	206	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	3.87e-22	89	273	20	193	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA60858.1|CBM18|GH16_19	9.38e-293	1	435	1	435
BCS29145.1|CBM18|GH16_19	7.06e-218	1	435	1	433
CAK39569.1|CBM18|GH16_19	4.38e-181	1	433	1	422
BCR85298.1|CBM18|GH16_19	1.30e-172	1	433	1	420
BCR94459.1|CBM18|GH16_19	1.06e-170	1	433	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	6.98e-28	82	328	15	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1GBG_A	1.27e-06	136	273	72	194	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3WVJ_A	2.45e-06	78	273	17	196	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
3D6E_A	2.68e-06	136	273	59	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1BYH_A	3.10e-06	72	278	9	208	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	2.65e-182	1	433	1	441	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|Q5AJC0|UTR2_CANAL	1.28e-103	6	343	4	352	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|P32623|CRH2_YEAST	1.81e-93	28	344	27	345	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q75A41|CRR1_ASHGO	1.83e-61	27	301	30	362	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|Q05790|CRR1_YEAST	2.33e-57	27	301	30	354	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999749	CS pos: 19-20. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in AN4515-T-p1.