CAZyme Information: AN4395-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN4395-T-p1
• CAZy Family: GH28
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu4g06870, A. niger CBS 513.88 : An04g01260, A. oryzae RIB40 : AO090023000901, Aspergillus wentii : Aspwe1_0023285 and Aspergillus sydowii : Aspsy1_0545881

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		46927.12	6.0220

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrIII_A_nidulans_FGSC_A4:2162877-2164331(-)

Full Sequence      

MLLPKGGVTWKSARARLPPWRAILVLVTRTRFLISLAITGLIVLLWRGISSSASEMQNFY
CYGPPKAPMDMSLNEITEWTAHAQTPVLFNYHEPYEVNSSSIKNVDLNPIKSTNQAVQNR
ERVLILTPLRDASFHLNRYFDLIYKLTYPHELIDLAFLVGDTKDDTLATLASELQRIQDQ
GDKVAFRSATIIQKDFGTDFEMNVEDRHSFAAQGPRRKAIGRARNYLLYSALKPDHSWVY
WRDVDIVDSPDTILEDFIAHDKDILVPNIWFHRYKDGVDIEGRFDYNSWIESDKGRRLRA
TLDPDTILAEGYKEYDTGREYLVGMGDWRNDKDKEVELDGIGGVNIVVKADVHRSGINFP
AYAFENQAETEGFARMAKRAGYQVIGLPNYVVWHIDTDEKPGNLGDRKAY

Enzyme Prediction     

No EC number prediction in AN4395-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	362	8.8e-109	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.21e-154	101	363	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29009.1|GT62	4.80e-289	1	410	1	409
BAE59398.1|GT62	5.00e-273	1	410	1	410
QRD86028.1|GT62	5.00e-273	1	410	1	410
QMW29646.1|GT62	5.00e-273	1	410	1	410
QMW41718.1|GT62	5.00e-273	1	410	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.36e-65	102	398	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	3.05e-96	120	395	97	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	2.61e-94	88	395	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	1.67e-76	100	395	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	2.83e-74	96	395	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	3.62e-68	96	394	67	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999984	0.000007

TMHMM  Annotations     

There is no transmembrane helices in AN4395-T-p1.