CAZyme Information: AN4084-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN4084-T-p1
• CAZy Family: GH28
• CAZyme Description: Ortholog of A. fumigatus Af293 : Afu1g05595, A. niger CBS 513.88 : An18g04440, A. oryzae RIB40 : AO090009000381, Aspergillus wentii : Aspwe1_0025280 and Aspergillus sydowii : Aspsy1_0149732

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	ChrII_A_nidulans_FGSC_A4|CGC14	67578.61	5.6463

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:2146680-2148465(+)

Full Sequence      

MRLFHRYNYYGNAISPAAGRAGDESSQSPSSFSNRNIAPSPPSTSLTPFLQPSEPLDDTI
DRFPSDIHPVTALVEDAEQRFNKLLERQSRTLSDAVKEYRRRYNMHPPPHFDKWFSFARS
KGVELIDEYDTIYHSLLPFWALTPQTIRARAREALGYDNGLFGVLIRDGKVSLAEGLDGE
HEWQREATLGMMKNFIRYLPDMDLAFNAHDEPRVIVPSEDLQRLVAIAKNSVIPNAFKAK
SLVNEWSARPEDLNKGDRIDEVRTTRFNKISHQPAWTSSRISCPVDSPVRSLDENSPDDT
TGYASWELGFIHNTTAFSDVCNTPSLRYTYGFFDRPNVFAVVHDLFPVFSQSKVSTFQDI
LYPSPWYWANKVPYNMQNDYIWEEKIDKLYWRGSTTGGFSKGGGWRRHHRQLMVSNINAL
DNAKVLSKTDGGQWEVKEMDRSEYRDLFDVQFTSVGQCDRNDCAAQMEFFNITESVEQEE
AWAYKYLLDIDGNAFSGRYHAFLKSNSLVCKTALFREWHDERLKPWVHYVPISLKGSELL
ETMRYLSSEEEGEVVASRIAQNGKAWAQSTLRNEDMEVWFFRLLLE

Enzyme Prediction     

No EC number prediction in AN4084-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	323	586	7.1e-82	0.964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.88e-18	343	586	28	248	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.03e-09	347	586	108	318	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58972.1|GT90	0.0	27	586	26	585
BCS23821.1|GT90	3.51e-299	32	586	34	587
BCR83603.1|GT90	6.14e-285	64	586	62	584
QMW37147.1|GT90	1.93e-284	41	586	49	593
QMW25089.1|GT90	1.93e-284	41	586	49	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.53e-09	347	584	154	372	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	5.13e-08	324	586	95	337	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.57e-60	68	586	152	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8T045|RUMI_DROME	8.12e-09	347	584	166	384	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	5.70e-08	347	584	164	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.99e-07	324	586	123	365	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	8.71e-07	381	583	296	458	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000002

TMHMM  Annotations     

There is no transmembrane helices in AN4084-T-p1.