CAZyme Information: AN4052-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN4052-T-p1
• CAZy Family: GH27
• CAZyme Description: Cell wall glucan 1,6-beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	ChrII_A_nidulans_FGSC_A4|CGC7	45301.47	4.2993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:2228421-2229767(-)

Full Sequence      

MFPRISQAAILAHSLLAVCTSAATLLQPRANPSAEKVRGVNLGGWLVLEPWITPSLFDEA
GDEAVDEYTLTEVLGVEEAAARLSEHWNTFITEEDFALIAEAGLNYVRIPIGYWAAAPLD
GEPYVSGQLEHLDNAVAWARAHNLKVIVDLHGAPGSQNGFDNSGRRGPIGWQQGDTVEQT
ILAFETLAQRYLADDDTVTMIEALNEPHVPGGINQDQLKDYYEETLARVRKNSPEATLLL
HDGFVQTEGWNGFMTGENVMMDTHHYEVFEGGQNAWSIEKHIDAACQLGRQHLQAADKPV
IVGEWTGALSDCTRYLNGKGIGIRYDGTLGSNTAVGACGSKSEGSVAGLSADEIANTRRF
IEAQLDAFELRNGWVFWTWKTEGAPGWDMQDLLANGVFPQPLTDREFPNQCNF

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	85	382	1.3e-111	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.16e-67	29	412	10	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.34e-18	90	305	24	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA59523.1|GH5_9	2.88e-296	26	413	99	486
BCS23851.1|GH5_9	4.75e-229	1	411	1	411
CAK43212.1|GH5_9	1.16e-192	1	412	1	416
QMW28378.1|GH5_9	1.00e-188	1	411	1	415
QRD82870.1|GH5_9	1.00e-188	1	411	1	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.89e-122	37	413	9	393	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	5.80e-122	37	413	9	393	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	7.06e-122	37	413	15	399	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	2.00e-121	37	413	15	399	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	2.00e-121	37	413	15	399	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	5.76e-306	1	413	1	405	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|A2RAR6|EXGA_ASPNC	2.06e-193	1	412	1	416	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	9.16e-190	37	411	42	415	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	3.72e-189	37	411	42	415	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	5.27e-189	37	411	42	415	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.689248	0.310748

TMHMM  Annotations     

There is no transmembrane helices in AN4052-T-p1.