CAZyme Information: AN3977-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3977-T-p1
• CAZy Family: PL4
• CAZyme Description: Has domain(s) with predicted role in cell wall macromolecule catabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		39525.65	8.2758

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:2450051-2451460(+)

Full Sequence      

MSLTTRGYNPSITASCEGFKPGKSHCVEAWGEPAPTKPPTTITTPTTTTTTTTTKTGNAP
GTTQAGQIGTCNRWDLVKSGDSGNVFLEKYSGLTLANLVRWNPAIGSRCQSLWVDTYGAP
TPSTTTTTMTAPVYGITTPSPIQPGIVDDCNDFHKVQSGDTCASIARSAGISLSQPADLA
LKFTSWNPGVGNGCSSLWLGYFVCISRVGVTATITMTTTTSGNGIFTPTPTLPGMVKNCD
TFYLVKSGDGCAAIASSKGISLSQLYAWNPNLGSDCSGLWSEYYICVSIVGVNPTSTTKT
TTKTTTSTKGNGVSTPTSIQAGMTSSCNKFHKVVSGDQCGTIASNAGITLANFLKWNPGV
GGFACRSLWLGYYVCIGVL

Enzyme Prediction     

No EC number prediction in AN3977-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	5.78e-10	241	285	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.99e-08	153	203	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	4.51e-07	153	205	1	44	Lysin motif.
212030	LysM	2.70e-06	329	374	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	3.27e-06	242	275	1	34	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7022339.1|CBM50	1.97e-113	6	379	69	451
EGX53201.1|CBM50	3.37e-97	8	379	73	449
VBB80752.1|CBM50	5.20e-93	6	379	74	436
VBB80356.1|CBM50	8.73e-88	6	379	74	458
QYT04780.1|CBM50	5.24e-86	8	368	231	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PXV_A	2.81e-07	241	288	3	48	Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.10e-88	9	379	98	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	3.46e-15	160	291	39	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	4.49e-15	59	295	250	542	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	5.42e-15	139	289	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.54e-13	320	378	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999835	0.000217

TMHMM  Annotations     

There is no transmembrane helices in AN3977-T-p1.