CAZyme Information: AN3588-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3588-T-p1
• CAZy Family: GH18
• CAZyme Description: Ortholog(s) have alpha-1,6-mannosyltransferase activity, role in dolichol-linked oligosaccharide biosynthetic process, protein glycosylation and endoplasmic reticulum localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	ChrII_A_nidulans_FGSC_A4|CGC21	65463.70	9.8658

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:3676113-3677986(-)

Full Sequence      

MWRNVGYLLLLASIPVLVLFHLSIAPYTKVEESFHIQAIHDIETYGIPTHNVKDVLQAEY
DHFTFPGAVPRTFAGAVALSGLSSPIIWLKHDIDRQFVARAILGLFNASSLLYFASSLRR
TAGRATAIWYLLFQASQFHVLYYASRTLSNMFAFGMTTFALASLLPEPVSSATYRKRSRV
ALYLITIAGIVFRAELALFLATHTLFLLASGRISIQREIIPAGALGLVLGQAITLPIDSF
FWQQYPLWPEFTAFKFNVVAGQASAWGTHPWHYYFTNALPRLLLNPLTYLIGIPISLLQP
ATRGIATSILIPSLAYIAIYSIQPHKEWRFIVYSIPSLTAAAALGTSYIWTHRTKSFIYR
FLSLGMIVSTLFSFLLSSFALLPASSANYPGAHALNALHNHVLSAAPKSARGQHEPITVS
VHLGNLACQTGVTRFLQLSDDRSKQQGSNISSTISWSYDKSPPPASLSAMQTFWSRFDYV
LLEPHEAETLLSLSGSPTEYAYSQSYAWETVDSVTGFAGLHVLRPGEEASGGVEEGILKW
LFGRKVNEWGILHSWRKIREGIRESVSKGWWVEVKMKEKIRILGRVR

Enzyme Prediction     

No EC number prediction in AN3588-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	10	404	5.6e-86	0.9254498714652957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	8.18e-38	60	379	44	365	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	2.52e-12	79	336	108	348	mannosyltransferase
224720	ArnT	6.41e-05	97	382	84	364	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA59796.1|GT22	0.0	6	587	83	620
BCS27236.1|GT22	0.0	1	587	1	581
BCS08490.1|GT22	7.53e-257	1	583	1	553
BCR95959.1|GT22	7.53e-257	1	583	1	553
CAK43935.1|GT22	2.45e-256	7	585	22	573

PDB Hits     

AN3588-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53730|ALG12_YEAST	1.50e-67	20	519	16	490	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG12 PE=1 SV=1
sp|Q23361|ALG12_CAEEL	2.22e-64	16	482	10	431	Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Caenorhabditis elegans OX=6239 GN=algn-12 PE=1 SV=2
sp|Q8VDB2|ALG12_MOUSE	2.03e-62	2	461	12	416	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg12 PE=2 SV=2
sp|Q9BV10|ALG12_HUMAN	4.29e-60	9	460	12	416	Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG12 PE=1 SV=1
sp|Q9USD4|ALG12_SCHPO	1.49e-57	26	487	28	434	Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg12 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996981	0.003060

TMHMM  Annotations     

Start	End
5	27
67	89
96	115
125	144
180	202
278	297
304	323
328	350
357	379