CAZyme Information: AN3531-T-p1

Basic Information

• Species: Aspergillus nidulans
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus nidulans
• CAZyme ID: AN3531-T-p1
• CAZy Family: GH18
• CAZyme Description: Putative D-sorbitol dehydrogenase (acceptor) with a predicted role in mannose/mannitol, fructose, and sorbose/sorbitol metabolism

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	ChrII_A_nidulans_FGSC_A4|CGC21	59537.79	5.5707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnidulansFGSCA4	10988	227321	276	10712

• Gene Location: location=ChrII_A_nidulans_FGSC_A4:3870382-3872049(-)

Full Sequence      

MSEIHYDYIIIGGGLAGCTLAGRLAEKNRSLQILIIEAGPNVAGHTLTEYPLACFGAHFS
PLDWAYTTVPQTHLDNRMCYNSAAKALGGGSAINYGTWTRGNAADYDRWAAMVDDESWGY
EALLPYFKRMENCLDCKGTETGAHGVSGPIHNVSVSGGSADRIYPLREPLRRAWERLGVK
EVLDANAGSPLGLGELVENWREGRRQITADVFNILERPGITTLTETMVQKILIEKDQQGK
KVAKGVQVVQGPVFLADREVIVSAGAYRTPQILMLSGIGPKDELAKLGIAAVADAPGVGQ
NLHDHFAFVQWWRLRHPEKGLSIGTPLWDSLAYGMGLPCDWIATLQAPRNELVQALHQDG
ATDVGSHPYLAPDACHVETLIVYAPAGAAVSRIEIPMDGTHIASAVLGMATTSRGRITLA
SADATTAPLIDPNYYATEFDRAVLRAGIRQVGKLLLETPEGKETVEAEAPHPGFQALGVE
PTDVEIDARVKAGGNTFYHPGGTAAMGKVVDTSLRVIGVEGLRVVDASVLPLPVTAHYQA
LVYAIADKAADLILS

Enzyme Prediction     

No EC number prediction in AN3531-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	554	9.4e-146	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.21e-110	1	554	1	532	choline dehydrogenase; Validated
225186	BetA	8.35e-97	1	555	3	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.08e-38	412	549	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.87e-35	75	305	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.54e-31	6	530	56	553	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58856.1|AA3_2	0.0	1	555	1	555
BCS24407.1|AA3_2	9.96e-302	6	553	4	559
BCS16263.1|AA3_2	1.17e-248	6	555	5	553
BCS04695.1|AA3_2	1.17e-248	6	555	5	553
CAK40717.1|AA3_2	1.36e-247	6	554	5	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.40e-62	5	553	6	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.95e-62	5	553	6	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.72e-62	5	553	6	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	3.03e-57	2	553	37	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	8.60e-55	1	553	1	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	1.16e-130	6	555	5	520	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.20e-66	6	555	7	535	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.04e-62	5	553	42	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.94e-62	2	553	37	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	4.13e-62	5	553	45	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998627	0.001396

TMHMM  Annotations     

There is no transmembrane helices in AN3531-T-p1.